Align β-ketoadipyl-CoA thiolase (EC 2.3.1.174; EC 2.3.1.223) (characterized)
to candidate WP_073041043.1 BUB04_RS15265 acetyl-CoA C-acyltransferase
Query= metacyc::MONOMER-15952 (401 letters) >NCBI__GCF_900129305.1:WP_073041043.1 Length = 397 Score = 283 bits (725), Expect = 5e-81 Identities = 175/405 (43%), Positives = 226/405 (55%), Gaps = 20/405 (4%) Query: 1 MNEALIIDAVRTPIGRYA--GALASVRADDLGAIPLKALIARHPQLDWSAVDDVIYGCAN 58 + E +++D+VRTP GR G RA+DL LKAL+ R+P LD S V+D ++G N Sbjct: 5 VQEVVVVDSVRTPFGRAGEKGIYWKTRAEDLAVAVLKALVERNPALDPSQVEDCLWGVTN 64 Query: 59 QAGEDNRNVARMAALLAGLPVSVPGTTLNRLCGSGLDAVGSAARALRCGEAGLMLAGGVE 118 Q E + RM +LLA VPG +++R+C GL AV A + G A +++GGVE Sbjct: 65 QVKEQGGTLGRMVSLLADWGWGVPGCSIDRMCAGGLTAVHFGASVIASGMADCIVSGGVE 124 Query: 119 SMSRAPFVMGKSEQAFGRSAEIFDTTIGWRFVNKLMQQGFGIDSMPETAENVAAQF-NIS 177 M P MG R+ E SM TAEN+ Q+ +++ Sbjct: 125 HMGHLP--MGVFRDLHPRAVEALGDETAL--------------SMGLTAENIHDQWPDLT 168 Query: 178 RADQDAFALRSQHKAAAAIANGRLAKEIVAVEIAQRKGPAKIVEHDEHPRGDTTLEQLAK 237 R D +A SQ KA+ AI G++ IV +E+ G +VE D+ PR TTLE LA+ Sbjct: 169 RERADRYAWLSQQKASMAIQAGKMGDMIVPMEVELPDGTRTVVERDQTPRPTTTLEGLAQ 228 Query: 238 LGTPFRQGGSVTAGNASGVNDGACALLLASSEAAQRHGLKARARVVGMATAGVEPRIMGI 297 L FR G VTAGNA + DGA ++L S A+ GL+ R R V A V+PRIMG Sbjct: 229 LQPVFRPDGRVTAGNACPLTDGAAGVVLMSRRKAESLGLRPRMRWVATGVAAVDPRIMGT 288 Query: 298 GPVPATRKVLELTGLALADMDVIELNEAFAAQGLAVLRELGLADDDERVNPNGGAIALGH 357 PVPAT K LE GLAL MD+IE+NEAFA Q L L +GLA+DD RVN GGAIA GH Sbjct: 289 APVPATCKALEKAGLALDQMDIIEINEAFAVQVLYFLDRMGLAEDDPRVNIWGGAIAYGH 348 Query: 358 PLGMSGARLVTTALHELEER-QGRYALCTMCIGVGQGIALIIERI 401 PL SG RLV ER RY L TMC+G GQG+++I E + Sbjct: 349 PLAASGPRLVAFLQRLFAERPDARYGLTTMCVGRGQGVSIIWENL 393 Lambda K H 0.319 0.134 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 424 Number of extensions: 27 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 401 Length of database: 397 Length adjustment: 31 Effective length of query: 370 Effective length of database: 366 Effective search space: 135420 Effective search space used: 135420 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory