Align acetyl-CoA C-acetyltransferase (EC 2.3.1.9) (characterized)
to candidate WP_073041860.1 BUB04_RS17410 acetyl-CoA C-acetyltransferase
Query= BRENDA::P45359 (392 letters) >NCBI__GCF_900129305.1:WP_073041860.1 Length = 400 Score = 399 bits (1025), Expect = e-116 Identities = 213/395 (53%), Positives = 276/395 (69%), Gaps = 5/395 (1%) Query: 2 KEVVIASAVRTAIGSYGKSLKDVPAVDLGATAIKEAVKKAGIK-PEDVNEVILGNVLQAG 60 ++VVI SA RT IG +G SLKDV A L A +KE +K+AG P ++EV+ G+ Q Sbjct: 5 RDVVIVSAARTPIGKFGGSLKDVRASSLLALVMKEVLKRAGNPDPSILDEVVTGDCAQCF 64 Query: 61 LGQNPARQASFKAGLPVEIPAMTINKVCGSGLRTVSLAAQIIKAGDADVIIAGGMENMSR 120 N AR A KAGLPVEIPA TI + C S ++ ++ A Q+IKAGDADV++ GG+E+MS Sbjct: 65 DEANTARTAMLKAGLPVEIPAHTIQRQCASSMQALAAATQMIKAGDADVVLVGGVESMSS 124 Query: 121 APYLANNARWGYRMGNAKFVD---EMITDGLWDAFNDYHMGITAENIAERWNISREEQDE 177 APY NARWG R+ N + VD EM+ G N MG TAEN+AE++ ISR+EQDE Sbjct: 125 APYYLPNARWGMRLMNHEVVDSVWEMLHSGSRLLGNPMIMGQTAENLAEKYGISRQEQDE 184 Query: 178 FALASQKKAEEAIKSGQFKDEIVPVVIKGRKGETVV-DTDEHPRFGSTIEGLAKLKPAFK 236 AL S AE AIK G+FKD+IVPV I G KG+T V + DEHPRFG T++ LAKLKP FK Sbjct: 185 VALRSHHNAETAIKEGRFKDQIVPVEIPGPKGKTAVFEQDEHPRFGLTMDDLAKLKPVFK 244 Query: 237 KDGTVTAGNASGLNDCAAVLVIMSAEKAKELGVKPLAKIVSYGSAGVDPAIMGYGPFYAT 296 KDGTVTAGN+SGLND AA ++M+ KAKE+G++PLA+IV+ +AGV+P MGYGP AT Sbjct: 245 KDGTVTAGNSSGLNDGAAAALVMTRAKAKEMGLEPLARIVATAAAGVEPEYMGYGPVPAT 304 Query: 297 KAAIEKAGWTVDELDLIESNEAFAAQSLAVAKDLKFDMNKVNVNGGAIALGHPIGASGAR 356 ++KAG T+ ++ LIE NEAFAAQ +A + + FD NVNG I LGHP+G +G R Sbjct: 305 DKVLKKAGMTLKDIQLIELNEAFAAQYIACERGIGFDRAIANVNGSGIGLGHPVGCTGLR 364 Query: 357 ILVTLVHAMQKRDAKKGLATLCIGGGQGTAILLEK 391 I+++L + M +RD GLATLC+GGG G A ++ + Sbjct: 365 IVISLAYEMARRDLSIGLATLCVGGGMGMATIVAR 399 Lambda K H 0.315 0.132 0.375 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 480 Number of extensions: 20 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 392 Length of database: 400 Length adjustment: 31 Effective length of query: 361 Effective length of database: 369 Effective search space: 133209 Effective search space used: 133209 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
Align candidate WP_073041860.1 BUB04_RS17410 (acetyl-CoA C-acetyltransferase)
to HMM TIGR01930 (acetyl-CoA C-acyltransferase (EC 2.3.1.16))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01930.hmm # target sequence database: /tmp/gapView.31904.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01930 [M=385] Accession: TIGR01930 Description: AcCoA-C-Actrans: acetyl-CoA C-acyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3e-147 476.5 2.3 3.4e-147 476.3 2.3 1.0 1 lcl|NCBI__GCF_900129305.1:WP_073041860.1 BUB04_RS17410 acetyl-CoA C-acety Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_900129305.1:WP_073041860.1 BUB04_RS17410 acetyl-CoA C-acetyltransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 476.3 2.3 3.4e-147 3.4e-147 1 384 [. 9 397 .. 9 398 .. 0.98 Alignments for each domain: == domain 1 score: 476.3 bits; conditional E-value: 3.4e-147 TIGR01930 1 ivdavRtpigklggslkelsaedLlaavikellera.gldpekidevilGnvlqageqaniaReaalaa 68 iv+a+Rtpigk+ggslk+++a++Lla v+ke+l+ra + dp+ +dev++G q ++an+aR+a+l+a lcl|NCBI__GCF_900129305.1:WP_073041860.1 9 IVSAARTPIGKFGGSLKDVRASSLLALVMKEVLKRAgNPDPSILDEVVTGDCAQCFDEANTARTAMLKA 77 8***********************************9******************************** PP TIGR01930 69 glpesvpaltvnrvCaSglqAvalaaqkikaGeadvvvaGGvEsmSrvpillkaslrreslklgkakle 137 glp ++pa+t++r+CaS++qA+a a q+ikaG+advv++GGvEsmS++p++l+++ r++++l + ++ lcl|NCBI__GCF_900129305.1:WP_073041860.1 78 GLPVEIPAHTIQRQCASSMQALAAATQMIKAGDADVVLVGGVESMSSAPYYLPNA--RWGMRLMNHEVV 144 ******************************************************8..899999999999 PP TIGR01930 138 dqllkdl......vktklsmgetAenlakkygisReeqDeyalrShqkaakAieegkfkdeivpvevkg 200 d++ + l + + mg+tAenla+kygisR+eqDe alrSh++a++Ai+eg+fkd+ivpve++g lcl|NCBI__GCF_900129305.1:WP_073041860.1 145 DSVWEMLhsgsrlLGNPMIMGQTAENLAEKYGISRQEQDEVALRSHHNAETAIKEGRFKDQIVPVEIPG 213 9888877899*998889***************************************************9 PP TIGR01930 201 k...kkvvskDegirpnttlekLakLkpafkekkgstvtAgNssqlnDGAaalllmseevakelgltpl 266 + v+++De++r ++t+++LakLkp+fk+ +g tvtAgNss+lnDGAaa+l+m++++ake+gl+pl lcl|NCBI__GCF_900129305.1:WP_073041860.1 214 PkgkTAVFEQDEHPRFGLTMDDLAKLKPVFKK-DG-TVTAGNSSGLNDGAAAALVMTRAKAKEMGLEPL 280 999999************************95.9*.6******************************** PP TIGR01930 267 arivsaavagvdpeemglgpvpAiekaLkkaglsisdidlvEinEAFAaqvlavekelgsldlekvNvn 335 ariv++a agv+pe+mg+gpvpA+ k+Lkkag++++di+l+E+nEAFAaq++a+e+ +g d++ Nvn lcl|NCBI__GCF_900129305.1:WP_073041860.1 281 ARIVATAAAGVEPEYMGYGPVPATDKVLKKAGMTLKDIQLIELNEAFAAQYIACERGIG-FDRAIANVN 348 ***********************************************************.779****** PP TIGR01930 336 GGAiAlGHPlGasGarivltllkeLkergkkyGlatlCvggGqGaAvil 384 G+ i lGHP+G++G riv++l++e+++r+ +GlatlCvggG+G+A+i+ lcl|NCBI__GCF_900129305.1:WP_073041860.1 349 GSGIGLGHPVGCTGLRIVISLAYEMARRDLSIGLATLCVGGGMGMATIV 397 ***********************************************97 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (385 nodes) Target sequences: 1 (400 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.02u 0.00s 00:00:00.02 Elapsed: 00:00:00.02 # Mc/sec: 7.57 // [ok]
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory