Align β-ketoadipyl-CoA thiolase (EC 2.3.1.174; EC 2.3.1.223) (characterized)
to candidate WP_073041860.1 BUB04_RS17410 acetyl-CoA C-acetyltransferase
Query= metacyc::MONOMER-15952 (401 letters) >NCBI__GCF_900129305.1:WP_073041860.1 Length = 400 Score = 305 bits (780), Expect = 2e-87 Identities = 172/399 (43%), Positives = 240/399 (60%), Gaps = 6/399 (1%) Query: 3 EALIIDAVRTPIGRYAGALASVRADDLGAIPLKALIARHPQLDWSAVDDVIYGCANQAGE 62 + +I+ A RTPIG++ G+L VRA L A+ +K ++ R D S +D+V+ G Q Sbjct: 6 DVVIVSAARTPIGKFGGSLKDVRASSLLALVMKEVLKRAGNPDPSILDEVVTGDCAQCF- 64 Query: 63 DNRNVARMAALLAGLPVSVPGTTLNRLCGSGLDAVGSAARALRCGEAGLMLAGGVESMSR 122 D N AR A L AGLPV +P T+ R C S + A+ +A + ++ G+A ++L GGVESMS Sbjct: 65 DEANTARTAMLKAGLPVEIPAHTIQRQCASSMQALAAATQMIKAGDADVVLVGGVESMSS 124 Query: 123 APFVMGKSEQAFG-RSAEIFDTTIGWRFVNKLMQQGFGIDSMPETAENVAAQFNISRADQ 181 AP+ + + + E+ D+ W ++ + M +TAEN+A ++ ISR +Q Sbjct: 125 APYYLPNARWGMRLMNHEVVDSV--WEMLHSGSRLLGNPMIMGQTAENLAEKYGISRQEQ 182 Query: 182 DAFALRSQHKAAAAIANGRLAKEIVAVEIAQRKGPAKIVEHDEHPRGDTTLEQLAKLGTP 241 D ALRS H A AI GR +IV VEI KG + E DEHPR T++ LAKL Sbjct: 183 DEVALRSHHNAETAIKEGRFKDQIVPVEIPGPKGKTAVFEQDEHPRFGLTMDDLAKLKPV 242 Query: 242 FRQGGSVTAGNASGVNDGACALLLASSEAAQRHGLKARARVVGMATAGVEPRIMGIGPVP 301 F++ G+VTAGN+SG+NDGA A L+ + A+ GL+ AR+V A AGVEP MG GPVP Sbjct: 243 FKKDGTVTAGNSSGLNDGAAAALVMTRAKAKEMGLEPLARIVATAAAGVEPEYMGYGPVP 302 Query: 302 ATRKVLELTGLALADMDVIELNEAFAAQGLAVLRELGLADDDERVNPNGGAIALGHPLGM 361 AT KVL+ G+ L D+ +IELNEAFAAQ +A E G+ D N NG I LGHP+G Sbjct: 303 ATDKVLKKAGMTLKDIQLIELNEAFAAQYIAC--ERGIGFDRAIANVNGSGIGLGHPVGC 360 Query: 362 SGARLVTTALHELEERQGRYALCTMCIGVGQGIALIIER 400 +G R+V + +E+ R L T+C+G G G+A I+ R Sbjct: 361 TGLRIVISLAYEMARRDLSIGLATLCVGGGMGMATIVAR 399 Lambda K H 0.319 0.134 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 414 Number of extensions: 18 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 401 Length of database: 400 Length adjustment: 31 Effective length of query: 370 Effective length of database: 369 Effective search space: 136530 Effective search space used: 136530 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory