Align L-allo-threonine aldolase (EC 4.1.2.49) (characterized)
to candidate WP_073041906.1 BUB04_RS17520 low specificity L-threonine aldolase
Query= BRENDA::O07051 (338 letters) >NCBI__GCF_900129305.1:WP_073041906.1 Length = 347 Score = 266 bits (679), Expect = 7e-76 Identities = 164/341 (48%), Positives = 204/341 (59%), Gaps = 11/341 (3%) Query: 4 IDLRSDTVTQPTDAMRQCMLHAEVGDDVYGEDPGVNALEAYGADLLGKEAALFVPSGTMS 63 I L SDT T+PTDAMR+ M AEVGD+ GEDP VN L DLLGKEAALF+P GTM Sbjct: 2 IPLASDTETKPTDAMRRAMAVAEVGDEQKGEDPTVNRLLERVCDLLGKEAALFLPGGTMC 61 Query: 64 NLLAVMSHCQRGEGAVLGSAAHIYRYEAQGSAVLGSVALQPVPMQ----ADGSLALADVR 119 NL+++ +H Q G+ + AHI R E+ GS V ++PV + G+L A + Sbjct: 62 NLISIKTHTQPGDAVLADHMAHIIRAESGGSPFASGVLIEPVFSERGIFTPGALEEAYAK 121 Query: 120 AAIAPDDVHFTPTRLVCLENTHN---GKVLPLPYLREMRELVDEHGLQLHLDGARLFNAV 176 AP TP RLVC+E THN G V L LR + + E GL LH+DGARL NAV Sbjct: 122 VRTAPWPYAPTP-RLVCVEQTHNFGGGTVWKLDELRAVHDKARELGLALHMDGARLLNAV 180 Query: 177 VASGHTVRELVAPFDSVSICLSKGLGAPVGSLLVGSHAFIARARRLRKMVGGGMRQAGIL 236 VA G RE A DSV I +KGLGAPVG++L GS FIARAR + M GG MRQAGI+ Sbjct: 181 VAGGVPAREFAACVDSVWIDFTKGLGAPVGAVLAGSADFIARARLYKHMFGGAMRQAGIV 240 Query: 237 AQAGLFALQQHVVRLADDHRRARQLAEGLAALPGIRLDLAQVQTNMVFLQLTS-GESAP- 294 A L AL HV RLA+DH AR+L GL+ +PGIR+ + +TNMVF ++ G P Sbjct: 241 AAGCLHALDHHVERLAEDHENARRLDRGLSDIPGIRVLTPEPETNMVFFEIPGLGMGVPA 300 Query: 295 LLAFMKARGILFSGYG-ELRLVTHLQIHDDDIEEVIDAFTE 334 A K RG+ G G +R VTHL + +DI+ + E Sbjct: 301 FTAEAKRRGVSLVGIGCGIRAVTHLDVSREDIDRAVAILAE 341 Lambda K H 0.322 0.137 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 357 Number of extensions: 19 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 338 Length of database: 347 Length adjustment: 29 Effective length of query: 309 Effective length of database: 318 Effective search space: 98262 Effective search space used: 98262 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory