Align acetate kinase (EC 2.7.2.15) (characterized)
to candidate WP_073041924.1 BUB04_RS17570 cupin domain-containing protein
Query= metacyc::STM2468-MONOMER (229 letters) >NCBI__GCF_900129305.1:WP_073041924.1 Length = 235 Score = 89.7 bits (221), Expect = 4e-23 Identities = 67/226 (29%), Positives = 103/226 (45%), Gaps = 11/226 (4%) Query: 2 KKLITANDIRAAHARGEQAMSVVLRASIITPEAREVAELLGFTITECDESVPASTSAQAC 61 K+L+T +D++AA G+ + I+TP A ++AE L I E P + Sbjct: 3 KELVTVSDVQAAADAGKDHIVAPRDRFIVTPAALDLAERLEIRILEDGSPAPLPAACPLA 62 Query: 62 KSESQRIREA-----IIAQLPEGQFTESLVAQLMEKVLKEKQS------LELGTMQPSFT 110 K E+ EA ++ + + E L + + LK+ + LE G PS Sbjct: 63 KDENAPETEAPADDRLVVEEVIRRVCERLEGHVDPERLKDVVARLVSCRLEGGAPAPSEE 122 Query: 111 SVTGKGGVKVIDGSSVKFGRFDGAEPHCVGLTDLVTEQDGSSMAAGFMQWDNAFFPWTLN 170 G GGV +D S D L V D +A +M W+ A F T+ Sbjct: 123 QDAGLGGVIFVDASHALAHEGDAPPIGEKVLVTGVLGGDDQKLAGAYMAWEQASFRRTVE 182 Query: 171 YDEIDMVLEGELHVRHEGETMIAKAGDVMFIPKGSSIEFGTPTSVR 216 EI +VLEGELH+ G T+ AK GD++++P+G + + TP+ VR Sbjct: 183 SPEIQVVLEGELHLTVGGRTLKAKPGDMLYLPEGVKVLYSTPSRVR 228 Lambda K H 0.317 0.131 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 125 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 229 Length of database: 235 Length adjustment: 23 Effective length of query: 206 Effective length of database: 212 Effective search space: 43672 Effective search space used: 43672 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory