Align Proline dehydrogenase 2; PRODH 2; Proline oxidase 2; EC 1.5.5.2 (characterized)
to candidate WP_075388400.1 BK574_RS14195 proline dehydrogenase
Query= SwissProt::P94390 (303 letters) >NCBI__GCF_002019605.1:WP_075388400.1 Length = 306 Score = 320 bits (820), Expect = 3e-92 Identities = 156/304 (51%), Positives = 212/304 (69%), Gaps = 3/304 (0%) Query: 1 MITRDFFLFLSKSGFLNKMARNWGSRVAAGKIIGGNDFNSSIPTIRQLNSQGLSVTVDHL 60 +I R+FFLFLSK+ LN+ AR WG ++ A +++ G + ++ +RQLN +GL TVDHL Sbjct: 4 VILRNFFLFLSKNQLLNQSARKWGLKLGASQVVAGETISQAMKVVRQLNQKGLVCTVDHL 63 Query: 61 GEFVNSAEVARERTEECIQTIATIADQELNSHVSLKMTSLGLDIDMDLVYENMTKILQTA 120 GEFV + E A + + CI+T+ IA +N ++SLK+T LGLD+D L YENM KIL A Sbjct: 64 GEFVTTKEEAIQSADYCIRTLNAIAKTGVNCNLSLKLTQLGLDVDSRLCYENMKKILSCA 123 Query: 121 EKHKIMVTIDMEDEVRCQKTLDIFKDFRKKYEH-VSTVLQAYLYRTEKDIDDLDSLNPFL 179 +KH+I V IDMED CQ+T+D+ + R +Y V T +QAYLYR D+ L LN L Sbjct: 124 KKHRIFVRIDMEDYSHCQQTIDLLEKLRNEYVGLVGTAIQAYLYRALDDVKHLKGLN--L 181 Query: 180 RLVKGAYKESEKVAFPEKSDVDENYKKIIRKQLLNGHYTAIATHDDKMIDFTKQLAKEHG 239 RLVKGAYKE ++A+ +K ++D NY +I++ L +G YTA+ATHD +ID K KE Sbjct: 182 RLVKGAYKEPPEIAYQKKEEIDANYLVMIKQHLRSGSYTAVATHDHHIIDKVKGFCKEEK 241 Query: 240 IANDKFEFQMLYGMRSQTQLSLVKEGYNMRVYLPYGEDWYGYFMRRLAERPSNIAFAFKG 299 I+ D+FEFQML+G R++ Q + KEGY MRVY+PYG DW+GYFMRRLAERP N++FA KG Sbjct: 242 ISKDQFEFQMLFGFRTELQEQIAKEGYKMRVYVPYGNDWFGYFMRRLAERPQNVSFALKG 301 Query: 300 MTKK 303 + K Sbjct: 302 LLSK 305 Lambda K H 0.320 0.135 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 279 Number of extensions: 14 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 303 Length of database: 306 Length adjustment: 27 Effective length of query: 276 Effective length of database: 279 Effective search space: 77004 Effective search space used: 77004 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory