GapMind for catabolism of small carbon sources

 

Protein WP_077244620.1 in Thioalkalivibrio halophilus HL17

Annotation: NCBI__GCF_001995255.1:WP_077244620.1

Length: 389 amino acids

Source: GCF_001995255.1 in NCBI

Candidate for 88 steps in catabolism of small carbon sources

Pathway Step Score Similar to Id. Cov. Bits Other hit Other id. Other bits
L-proline catabolism proV hi glycine betaine/l-proline transport atp-binding protein prov (characterized) 55% 99% 406.4 ABC-type quaternary amine transporter (EC 7.6.2.9) 47% 349.4
L-proline catabolism opuBA med BusAA, component of Uptake system for glycine-betaine (high affinity) and proline (low affinity) (OpuAA-OpuABC) or BusAA-ABC of Lactococcus lactis). BusAA, the ATPase subunit, has a C-terminal tandem cystathionine β-synthase (CBS) domain which is the cytoplasmic K+ sensor for osmotic stress (osmotic strength)while the BusABC subunit has the membrane and receptor domains fused to each other (Biemans-Oldehinkel et al., 2006; Mahmood et al., 2006; Gul et al. 2012). An N-terminal amphipathic α-helix of OpuA is necessary for high activity but is not critical for biogenesis or the ionic regulation of transport (characterized) 46% 96% 330.1 Glycine betaine/choline transport system ATP-binding protein OusV 54% 406.8
L-histidine catabolism hutV med ABC transporter for L-Histidine, ATPase component (characterized) 58% 95% 299.3 Glycine betaine/choline transport system ATP-binding protein OusV 54% 406.8
L-proline catabolism hutV med HutV aka HISV aka R02702 aka SMC00670, component of Uptake system for hisitidine, proline, proline-betaine and glycine-betaine (characterized) 54% 96% 283.5 Glycine betaine/choline transport system ATP-binding protein OusV 54% 406.8
D-maltose catabolism thuK lo Trehalose/maltose import ATP-binding protein MalK; EC 7.5.2.1 (characterized) 35% 83% 178.7 Glycine betaine/choline transport system ATP-binding protein OusV 54% 406.8
trehalose catabolism thuK lo Trehalose/maltose import ATP-binding protein MalK; EC 7.5.2.1 (characterized) 35% 83% 178.7 Glycine betaine/choline transport system ATP-binding protein OusV 54% 406.8
L-arabinose catabolism xacJ lo Xylose/arabinose import ATP-binding protein XacJ; EC 7.5.2.13 (characterized, see rationale) 42% 58% 177.9 Glycine betaine/choline transport system ATP-binding protein OusV 54% 406.8
L-histidine catabolism PA5503 lo Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN (characterized) 37% 81% 175.3 Glycine betaine/choline transport system ATP-binding protein OusV 54% 406.8
L-arabinose catabolism xacK lo Xylose/arabinose import ATP-binding protein XacK; EC 7.5.2.13 (characterized, see rationale) 34% 86% 170.2 Glycine betaine/choline transport system ATP-binding protein OusV 54% 406.8
D-mannitol catabolism mtlK lo ABC transporter for D-Mannitol, D-Mannose, and D-Mannose, ATPase component (characterized) 33% 79% 166 Glycine betaine/choline transport system ATP-binding protein OusV 54% 406.8
putrescine catabolism potA lo spermidine/putrescine ABC transporter, ATP-binding protein PotA; EC 3.6.3.31 (characterized) 38% 61% 166 Glycine betaine/choline transport system ATP-binding protein OusV 54% 406.8
sucrose catabolism thuK lo ABC transporter (characterized, see rationale) 37% 61% 166 Glycine betaine/choline transport system ATP-binding protein OusV 54% 406.8
D-cellobiose catabolism gtsD lo Sugar ABC transporter ATP-binding protein (characterized, see rationale) 33% 94% 165.6 Glycine betaine/choline transport system ATP-binding protein OusV 54% 406.8
D-glucose catabolism gtsD lo Sugar ABC transporter ATP-binding protein (characterized, see rationale) 33% 94% 165.6 Glycine betaine/choline transport system ATP-binding protein OusV 54% 406.8
lactose catabolism gtsD lo Sugar ABC transporter ATP-binding protein (characterized, see rationale) 33% 94% 165.6 Glycine betaine/choline transport system ATP-binding protein OusV 54% 406.8
D-maltose catabolism gtsD lo Sugar ABC transporter ATP-binding protein (characterized, see rationale) 33% 94% 165.6 Glycine betaine/choline transport system ATP-binding protein OusV 54% 406.8
sucrose catabolism gtsD lo Sugar ABC transporter ATP-binding protein (characterized, see rationale) 33% 94% 165.6 Glycine betaine/choline transport system ATP-binding protein OusV 54% 406.8
trehalose catabolism gtsD lo Sugar ABC transporter ATP-binding protein (characterized, see rationale) 33% 94% 165.6 Glycine betaine/choline transport system ATP-binding protein OusV 54% 406.8
D-maltose catabolism malK1 lo MalK; aka Sugar ABC transporter, ATP-binding protein, component of The maltose, maltotriose, mannotetraose (MalE1)/maltose, maltotriose, trehalose (MalE2) porter (Nanavati et al., 2005). For MalG1 (823aas) and MalG2 (833aas), the C-terminal transmembrane domain with 6 putative TMSs is preceded by a single N-terminal TMS and a large (600 residue) hydrophilic region showing sequence similarity to MLP1 and 2 (9.A.14; e-12 & e-7) as well as other proteins (characterized) 36% 60% 164.1 Glycine betaine/choline transport system ATP-binding protein OusV 54% 406.8
xylitol catabolism Dshi_0546 lo ABC transporter for Xylitol, ATPase component (characterized) 34% 73% 163.7 Glycine betaine/choline transport system ATP-binding protein OusV 54% 406.8
D-xylose catabolism gtsD lo ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized) 34% 77% 162.9 Glycine betaine/choline transport system ATP-binding protein OusV 54% 406.8
D-maltose catabolism musK lo ABC-type maltose transporter (EC 7.5.2.1) (characterized) 34% 71% 162.2 Glycine betaine/choline transport system ATP-binding protein OusV 54% 406.8
lactose catabolism lacK lo ABC transporter for Lactose, ATPase component (characterized) 39% 62% 161 Glycine betaine/choline transport system ATP-binding protein OusV 54% 406.8
D-sorbitol (glucitol) catabolism mtlK lo ABC transporter for D-Sorbitol, ATPase component (characterized) 31% 95% 160.6 Glycine betaine/choline transport system ATP-binding protein OusV 54% 406.8
D-maltose catabolism malK lo Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 (characterized) 38% 60% 158.7 Glycine betaine/choline transport system ATP-binding protein OusV 54% 406.8
D-mannose catabolism TT_C0211 lo Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 32% 81% 157.9 Glycine betaine/choline transport system ATP-binding protein OusV 54% 406.8
L-lysine catabolism hisP lo Amino-acid ABC transporter, ATP-binding protein (characterized, see rationale) 36% 95% 157.1 Glycine betaine/choline transport system ATP-binding protein OusV 54% 406.8
N-acetyl-D-glucosamine catabolism SMc02869 lo N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized) 35% 65% 155.2 Glycine betaine/choline transport system ATP-binding protein OusV 54% 406.8
L-asparagine catabolism aapP lo AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 38% 86% 155.2 Glycine betaine/choline transport system ATP-binding protein OusV 54% 406.8
L-aspartate catabolism aapP lo AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 38% 86% 155.2 Glycine betaine/choline transport system ATP-binding protein OusV 54% 406.8
D-glucosamine (chitosamine) catabolism SMc02869 lo N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized) 35% 65% 155.2 Glycine betaine/choline transport system ATP-binding protein OusV 54% 406.8
L-glutamate catabolism aapP lo AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 38% 86% 155.2 Glycine betaine/choline transport system ATP-binding protein OusV 54% 406.8
L-histidine catabolism aapP lo AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 38% 86% 155.2 Glycine betaine/choline transport system ATP-binding protein OusV 54% 406.8
L-leucine catabolism aapP lo AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 38% 86% 155.2 Glycine betaine/choline transport system ATP-binding protein OusV 54% 406.8
L-proline catabolism aapP lo AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 38% 86% 155.2 Glycine betaine/choline transport system ATP-binding protein OusV 54% 406.8
L-arabinose catabolism araV lo AraV, component of Arabinose, fructose, xylose porter (characterized) 36% 63% 154.8 Glycine betaine/choline transport system ATP-binding protein OusV 54% 406.8
D-fructose catabolism araV lo AraV, component of Arabinose, fructose, xylose porter (characterized) 36% 63% 154.8 Glycine betaine/choline transport system ATP-binding protein OusV 54% 406.8
D-galactose catabolism PfGW456L13_1897 lo ABC transporter for D-Galactose and D-Glucose, ATPase component (characterized) 32% 76% 154.8 Glycine betaine/choline transport system ATP-binding protein OusV 54% 406.8
sucrose catabolism araV lo AraV, component of Arabinose, fructose, xylose porter (characterized) 36% 63% 154.8 Glycine betaine/choline transport system ATP-binding protein OusV 54% 406.8
D-xylose catabolism araV lo AraV, component of Arabinose, fructose, xylose porter (characterized) 36% 63% 154.8 Glycine betaine/choline transport system ATP-binding protein OusV 54% 406.8
L-asparagine catabolism bztD lo BztD, component of Glutamate/glutamine/aspartate/asparagine porter (characterized) 38% 84% 154.5 Glycine betaine/choline transport system ATP-binding protein OusV 54% 406.8
L-aspartate catabolism bztD lo BztD, component of Glutamate/glutamine/aspartate/asparagine porter (characterized) 38% 84% 154.5 Glycine betaine/choline transport system ATP-binding protein OusV 54% 406.8
L-glutamate catabolism gltL lo BztD, component of Glutamate/glutamine/aspartate/asparagine porter (characterized) 38% 84% 154.5 Glycine betaine/choline transport system ATP-binding protein OusV 54% 406.8
D-alanine catabolism Pf6N2E2_5405 lo ABC transporter for D-Alanine, ATPase component (characterized) 37% 87% 154.1 Glycine betaine/choline transport system ATP-binding protein OusV 54% 406.8
D-maltose catabolism malK_Sm lo MalK, component of Maltose/Maltotriose/maltodextrin (up to 7 glucose units) transporters MalXFGK (MsmK (3.A.1.1.28) can probably substitute for MalK; Webb et al., 2008) (characterized) 34% 76% 154.1 Glycine betaine/choline transport system ATP-binding protein OusV 54% 406.8
trehalose catabolism malK lo MalK, component of Maltose/Maltotriose/maltodextrin (up to 7 glucose units) transporters MalXFGK (MsmK (3.A.1.1.28) can probably substitute for MalK; Webb et al., 2008) (characterized) 34% 76% 154.1 Glycine betaine/choline transport system ATP-binding protein OusV 54% 406.8
D-maltose catabolism malK_Aa lo ABC-type maltose transporter (EC 7.5.2.1) (characterized) 36% 56% 153.7 Glycine betaine/choline transport system ATP-binding protein OusV 54% 406.8
L-asparagine catabolism aatP lo Glutamate/aspartate transport ATP-binding protein GltL aka B0652, component of Glutamate/aspartate porter (characterized) 38% 93% 153.3 Glycine betaine/choline transport system ATP-binding protein OusV 54% 406.8
L-aspartate catabolism aatP lo Glutamate/aspartate transport ATP-binding protein GltL aka B0652, component of Glutamate/aspartate porter (characterized) 38% 93% 153.3 Glycine betaine/choline transport system ATP-binding protein OusV 54% 406.8
L-asparagine catabolism peb1C lo PEB1C, component of Uptake system for glutamate and aspartate (characterized) 38% 91% 152.9 Glycine betaine/choline transport system ATP-binding protein OusV 54% 406.8
L-aspartate catabolism peb1C lo PEB1C, component of Uptake system for glutamate and aspartate (characterized) 38% 91% 152.9 Glycine betaine/choline transport system ATP-binding protein OusV 54% 406.8
D-maltose catabolism malK_Bb lo ABC-type maltose transport, ATP binding protein (characterized, see rationale) 34% 75% 152.9 Glycine betaine/choline transport system ATP-binding protein OusV 54% 406.8
L-arginine catabolism artP lo Arginine transport ATP-binding protein ArtM (characterized) 38% 92% 151 Glycine betaine/choline transport system ATP-binding protein OusV 54% 406.8
L-fucose catabolism SM_b21106 lo ABC transporter for L-Fucose, ATPase component (characterized) 35% 62% 151 Glycine betaine/choline transport system ATP-binding protein OusV 54% 406.8
D-maltose catabolism aglK lo ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) 32% 73% 150.6 Glycine betaine/choline transport system ATP-binding protein OusV 54% 406.8
sucrose catabolism aglK lo ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) 32% 73% 150.6 Glycine betaine/choline transport system ATP-binding protein OusV 54% 406.8
trehalose catabolism aglK lo ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) 32% 73% 150.6 Glycine betaine/choline transport system ATP-binding protein OusV 54% 406.8
L-asparagine catabolism bgtA lo ATPase (characterized, see rationale) 39% 83% 149.8 Glycine betaine/choline transport system ATP-binding protein OusV 54% 406.8
L-aspartate catabolism bgtA lo ATPase (characterized, see rationale) 39% 83% 149.8 Glycine betaine/choline transport system ATP-binding protein OusV 54% 406.8
D-glucosamine (chitosamine) catabolism SM_b21216 lo ABC transporter for D-Glucosamine, ATPase component (characterized) 30% 86% 149.1 Glycine betaine/choline transport system ATP-binding protein OusV 54% 406.8
L-histidine catabolism hisP lo Histidine transport ATP-binding protein HisP (characterized) 35% 98% 148.3 Glycine betaine/choline transport system ATP-binding protein OusV 54% 406.8
xylitol catabolism HSERO_RS17020 lo ABC-type sugar transport system, ATPase component protein (characterized, see rationale) 32% 71% 147.1 Glycine betaine/choline transport system ATP-binding protein OusV 54% 406.8
D-cellobiose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 36% 60% 146.7 Glycine betaine/choline transport system ATP-binding protein OusV 54% 406.8
D-glucose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 36% 60% 146.7 Glycine betaine/choline transport system ATP-binding protein OusV 54% 406.8
lactose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 36% 60% 146.7 Glycine betaine/choline transport system ATP-binding protein OusV 54% 406.8
D-maltose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 36% 60% 146.7 Glycine betaine/choline transport system ATP-binding protein OusV 54% 406.8
sucrose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 36% 60% 146.7 Glycine betaine/choline transport system ATP-binding protein OusV 54% 406.8
trehalose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 36% 60% 146.7 Glycine betaine/choline transport system ATP-binding protein OusV 54% 406.8
L-histidine catabolism bgtA lo BgtA aka SLR1735, component of Arginine/lysine/histidine/glutamine porter (characterized) 38% 91% 146.4 Glycine betaine/choline transport system ATP-binding protein OusV 54% 406.8
D-cellobiose catabolism SMc04256 lo ABC transporter for D-Cellobiose and D-Salicin, ATPase component (characterized) 33% 73% 145.6 Glycine betaine/choline transport system ATP-binding protein OusV 54% 406.8
L-citrulline catabolism AO353_03040 lo ABC transporter for L-Arginine and L-Citrulline, ATPase component (characterized) 34% 98% 144.4 Glycine betaine/choline transport system ATP-binding protein OusV 54% 406.8
L-histidine catabolism Ac3H11_2560 lo ABC transporter for L-Histidine, ATPase component (characterized) 38% 76% 143.7 Glycine betaine/choline transport system ATP-binding protein OusV 54% 406.8
trehalose catabolism treV lo TreV, component of Trehalose porter (characterized) 33% 69% 141 Glycine betaine/choline transport system ATP-binding protein OusV 54% 406.8
L-citrulline catabolism PS417_17605 lo ATP-binding cassette domain-containing protein; SubName: Full=Amino acid transporter; SubName: Full=Histidine ABC transporter ATP-binding protein; SubName: Full=Histidine transport system ATP-binding protein (characterized, see rationale) 37% 90% 140.6 Glycine betaine/choline transport system ATP-binding protein OusV 54% 406.8
D-cellobiose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 33% 65% 140.2 Glycine betaine/choline transport system ATP-binding protein OusV 54% 406.8
D-galactose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 33% 65% 140.2 Glycine betaine/choline transport system ATP-binding protein OusV 54% 406.8
D-glucose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 33% 65% 140.2 Glycine betaine/choline transport system ATP-binding protein OusV 54% 406.8
L-histidine catabolism BPHYT_RS24015 lo ABC transporter related (characterized, see rationale) 35% 93% 140.2 Glycine betaine/choline transport system ATP-binding protein OusV 54% 406.8
lactose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 33% 65% 140.2 Glycine betaine/choline transport system ATP-binding protein OusV 54% 406.8
D-maltose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 33% 65% 140.2 Glycine betaine/choline transport system ATP-binding protein OusV 54% 406.8
D-mannose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 33% 65% 140.2 Glycine betaine/choline transport system ATP-binding protein OusV 54% 406.8
sucrose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 33% 65% 140.2 Glycine betaine/choline transport system ATP-binding protein OusV 54% 406.8
trehalose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 33% 65% 140.2 Glycine betaine/choline transport system ATP-binding protein OusV 54% 406.8
D-mannose catabolism TM1750 lo TM1750, component of Probable mannose/mannoside porter. Induced by beta-mannan (Conners et al., 2005). Regulated by mannose-responsive regulator manR (characterized) 35% 68% 136 Glycine betaine/choline transport system ATP-binding protein OusV 54% 406.8
glycerol catabolism glpS lo ABC transporter for Glycerol, ATPase component 1 (characterized) 31% 87% 133.7 Glycine betaine/choline transport system ATP-binding protein OusV 54% 406.8
L-tryptophan catabolism ecfA1 lo Energy-coupling factor transporter ATP-binding protein EcfA1; Short=ECF transporter A component EcfA; EC 7.-.-.- (characterized, see rationale) 35% 83% 130.2 Glycine betaine/choline transport system ATP-binding protein OusV 54% 406.8
D-mannose catabolism TM1749 lo TM1749, component of Probable mannose/mannoside porter. Induced by beta-mannan (Conners et al., 2005). Regulated by mannose-responsive regulator manR (characterized) 32% 73% 123.6 Glycine betaine/choline transport system ATP-binding protein OusV 54% 406.8
D-cellobiose catabolism TM0028 lo TM0028, component of β-glucoside porter (Conners et al., 2005). Binds cellobiose, laminaribiose (Nanavati et al. 2006). Regulated by cellobiose-responsive repressor BglR (characterized) 30% 71% 102.8 Glycine betaine/choline transport system ATP-binding protein OusV 54% 406.8

Sequence Analysis Tools

View WP_077244620.1 at NCBI

Find papers: PaperBLAST

Find functional residues: SitesBLAST

Search for conserved domains

Find the best match in UniProt

Compare to protein structures

Predict transmenbrane helices: Phobius

Predict protein localization: PSORTb

Find homologs in fast.genomics

Fitness BLAST: loading...

Sequence

MSDKLVVEDLYKIFGPRPHRALELMEQGLDKDAIFARTGNTVGVREASFSIREGEVFVIM
GLSGSGKSTMVRMFNRLIEPTAGHLYVNGEDITRMSRRQLIDLRRRDMSMVFQSFALLPH
KTVIENASLGLDVSGFDRARQQERALQALEAVGLGAHANSYPDELSGGMQQRVGLARALA
TDPTILLMDEAFSALDPLIRTEMQDELMRLQEQRSRTVVFISHDLDEAMRIGDRIAIMQG
GQVVQIGTPQEIVSNPANDYVRSFFYGVDVSQVYSAGDIARHDAMPLLQTGQADAAGARQ
QLGADGCAVLLDEGARFRGLVSARSLTDAADLDAARIDGIDTVEASTAMSDVLGRAAASD
WPLVVVEDGRFIGTLSQRDLLQTLDRTHQ

This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory