Align UDP-glucose 4-epimerase; EC 5.1.3.2; Galactowaldenase; UDP-galactose 4-epimerase (uncharacterized)
to candidate WP_077244986.1 B1A74_RS13995 NAD-dependent dehydratase
Query= curated2:Q56623 (328 letters) >NCBI__GCF_001995255.1:WP_077244986.1 Length = 318 Score = 295 bits (754), Expect = 1e-84 Identities = 146/311 (46%), Positives = 207/311 (66%), Gaps = 1/311 (0%) Query: 8 MPKSILLTGSTGFVGTNLVKSLTLKSDYIVKSAVRHAVNKDDGLLFEVG-DINASTDFEL 66 M + +L+TG+TGFVG +V+ L + + + R +V+ G V + D+ Sbjct: 1 MTQRVLVTGATGFVGGAVVQRLVAEGRLVPVAGCRRSVSVPAGAELAVTPSLGPEADWSS 60 Query: 67 PLKNTTVVVHCAARAHVMDDKEAEPLTLYREVNTAGTVNLAKQAIDSGVKRFIFISSIKV 126 L+ VVH AAR HVMD+ A+PL YR N GT+ LA+QA +GV+RF+F+SSIKV Sbjct: 61 ALQGVEAVVHAAARVHVMDEDAADPLAEYRRANVEGTLALARQAAQAGVRRFVFVSSIKV 120 Query: 127 NGEGTLVGCPFKTEDNHAPEDDYGLSKSEAEKQLVALAKDSSMEVVIIRPTIVYGPGVKA 186 NGE T G F D APED YG+SK+EAE L AL +++ ME+V +RP +VYGPG Sbjct: 121 NGEQTAPGSAFCAVDAPAPEDPYGVSKAEAEAALFALGRETGMEIVAVRPPLVYGPGAGG 180 Query: 187 NFASLMRLVSKGIPLPFGSITQNKRSLVSINNLVDLIVTCIDHPKAANQVFLVSDGHDVS 246 NFA + R V KG+PLP G++T+N+RSLV ++NLVDL+VTC++HP AAN+VFL DG D+S Sbjct: 181 NFARMARWVGKGVPLPLGAVTRNRRSLVGLDNLVDLLVTCLEHPAAANRVFLAGDGEDLS 240 Query: 247 TAEMVRELAIALDKPTWQLPVPIWCYKLFGKLFGKSDIVDRLTGTLQVDISHTKETLGWK 306 T +++R +A A+D+ LPVP + + G+ ++ RL +LQVDISHT+ETLGW+ Sbjct: 241 TTDLLRRVAAAMDRRARLLPVPPVLLRAAARAVGRGEMARRLLDSLQVDISHTRETLGWE 300 Query: 307 PPQTLQEGFKQ 317 PP ++ EG ++ Sbjct: 301 PPVSVDEGLRR 311 Lambda K H 0.318 0.134 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 249 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 328 Length of database: 318 Length adjustment: 28 Effective length of query: 300 Effective length of database: 290 Effective search space: 87000 Effective search space used: 87000 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory