Align UDP-glucose 4-epimerase (EC 5.1.3.2) (characterized)
to candidate WP_077278782.1 B1C78_RS08730 GDP-mannose 4,6-dehydratase
Query= BRENDA::P9WN67 (314 letters) >NCBI__GCF_002000365.1:WP_077278782.1 Length = 376 Score = 95.5 bits (236), Expect = 2e-24 Identities = 105/353 (29%), Positives = 154/353 (43%), Gaps = 55/353 (15%) Query: 2 RALVTGAAGFIGSTLVDRLLADGHSVVGLDNFATGRATN-LEHLADNSAHVFVEADIV-- 58 +AL+TG G GS L + LL G+ V G+ A+ T ++H+ + HV + I+ Sbjct: 3 KALITGITGQDGSYLAEFLLEKGYEVHGIKRRASSFNTQRIDHIYQDP-HVEGQNLILHY 61 Query: 59 -----TADLHAILEQHRPEVVFHLAAQIDVRRSVADPQFDAAVNVIGTVRLAEAARQTGV 113 +++L IL++ +P+ V++LAAQ V S P++ A V +GT+RL EA R G+ Sbjct: 62 GDLADSSNLTRILQEVQPDEVYNLAAQSHVAVSFESPEYTADVVALGTLRLLEAIRLLGM 121 Query: 114 RKIV--HTSSGGSIYGTPPEYPTPETAPTDPASPYAAGKVAGEIYLNTFRHLYGLDC--- 168 + V + +S +YG E P ET P P SPYA K+ +R YGL Sbjct: 122 ERKVRFYQASTSELYGLVQETPQRETTPFYPRSPYAVAKLYSYWITVNYREAYGLYACNG 181 Query: 169 ---SHIAP--ANVYGPRQDPHGEAGVVAIFAQALLSGKPTRVFGDGTNTRDYVFV----- 218 +H +P + R+ G A + L G D + RDYV V Sbjct: 182 ILFNHESPRRGETFVTRKITRGLANIAQGLEPCLYLGN-MNALRDWGHARDYVRVQWLML 240 Query: 219 -----DDVVDA---------FVRVSAD-VGGGLRFNIGTGKETSDRQLHSAVAAAVGGPD 263 +D V A FVR+SAD +G LRF G+ + + AVA P Sbjct: 241 QQEAPEDFVIATGRQCSVREFVRMSADALGVTLRFE---GEGVDEVAVVEAVADVECAPG 297 Query: 264 ----------DPEFHPPRLGDLKRSCLDIGLAERVLGWRPQIELADGVRRTVE 306 DP + P +++ D A LGW P+I L R VE Sbjct: 298 VRVGDVIVRVDPRYFRPT--EVETLLGDPTKARERLGWEPEITLEQMCREMVE 348 Lambda K H 0.320 0.137 0.410 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 268 Number of extensions: 20 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 314 Length of database: 376 Length adjustment: 29 Effective length of query: 285 Effective length of database: 347 Effective search space: 98895 Effective search space used: 98895 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory