Align UDP-glucose 4-epimerase; EC 5.1.3.2; Galactowaldenase; UDP-galactose 4-epimerase (uncharacterized)
to candidate WP_077279755.1 B1C78_RS13795 polysaccharide biosynthesis protein
Query= curated2:A8GWP0 (341 letters) >NCBI__GCF_002000365.1:WP_077279755.1 Length = 631 Score = 140 bits (353), Expect = 9e-38 Identities = 96/287 (33%), Positives = 149/287 (51%), Gaps = 26/287 (9%) Query: 1 MFVDKTLLITGGTGSFGNAVLSRFL----KNDIIKDIKEIRIFSRDEKKQEDMRIALNNP 56 + K +L+TG GS G+ ++ + + ++ D E ++S + + E + P Sbjct: 283 LLAGKRVLVTGAGGSIGSELVRQVAGYAPAHVVLLDQGEFNLYSIEREMAERDAV----P 338 Query: 57 KIKFYIGDVRNYNSIDDAMKDV------DYVFHAAALKQVPTCEFYPMEAINTNILGAEN 110 + DVR+ D M+++ D V HAAA K VP E P E I TN+ G Sbjct: 339 PYTAVLADVRD----DARMREIFEVHRPDIVLHAAAYKHVPLVEDNPDEGIRTNVFGTRV 394 Query: 111 VLRAATINKVAKVIVLSTDKAVYPINAMGLSKALMEKLAIAKARMNVRDKTVFCVTRYGN 170 V A V + +++STDKAV P N MG +K + E +N +T F TR+GN Sbjct: 395 VADLAGEYGVERFVLVSTDKAVNPTNVMGATKRVAELYCQG---LNAVSETAFITTRFGN 451 Query: 171 VMASRGSVIPLFINQIKQNKDLTITEPSMTRFLMSLVDSVDLVLYAFEYGHQGDIFV--Q 228 V+ S GSV+PLF QI++ +T+T P +TRF M++ ++V L+L A G G+IFV Sbjct: 452 VLGSAGSVVPLFREQIERGGPVTVTHPEITRFFMTIPEAVSLILQATAMGEGGEIFVLDM 511 Query: 229 KSPASTIEVLAK--ALQGIFNSKN-KIRFIGTRHGEKHYESLVSSEE 272 P +++ + L G+ K+ +IRF+G R GEK +E L +E Sbjct: 512 GEPVRIVDLAREMIRLSGLEPEKDVEIRFVGLRPGEKLHEELFHGQE 558 Lambda K H 0.319 0.135 0.373 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 387 Number of extensions: 20 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 341 Length of database: 631 Length adjustment: 33 Effective length of query: 308 Effective length of database: 598 Effective search space: 184184 Effective search space used: 184184 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory