Align acetyl-CoA:acetoacetyl-CoA transferase subunit &alpha (characterized)
to candidate WP_078427038.1 BK574_RS00550 acyl CoA:acetate/3-ketoacid CoA transferase subunit alpha
Query= ecocyc::ATOD-MONOMER (220 letters) >NCBI__GCF_002019605.1:WP_078427038.1 Length = 227 Score = 194 bits (492), Expect = 1e-54 Identities = 88/214 (41%), Positives = 143/214 (66%) Query: 4 KLMTLQDATGFFRDGMTIMVGGFMGIGTPSRLVEALLESGVRDLTLIANDTAFVDTGIGP 63 K+ + + F + T+M+GGF G+G+P +++ LL S + LT+I+ND F + GIG Sbjct: 5 KVKSSHEIFDFVKSSTTMMIGGFGGVGSPPTIIDTLLHSDINSLTIISNDAGFPNIGIGK 64 Query: 64 LIVNGRVRKVIASHIGTNPETGRRMISGEMDVVLVPQGTLIEQIRCGGAGLGGFLTPTGV 123 L+ + +V+K++ +HIG+NP G+ M ++++ VPQGT E++R GG GLGG L +G+ Sbjct: 65 LVCSNKVKKMVTTHIGSNPVAGQMMNEKKLEIEFVPQGTFAERVRAGGVGLGGILVDSGL 124 Query: 124 GTVVEEGKQTLTLDGKTWLLERPLRADLALIRAHRCDTLGNLTYQLSARNFNPLIALAAD 183 ++ + +T+ GK++ +E PL AD+++I A + DT GNL Y +ARN NPL+A+A + Sbjct: 125 QSLNSSKENRMTIGGKSYFVESPLVADISIIYAKKADTYGNLIYDKTARNMNPLMAMAGE 184 Query: 184 ITLVEPDELVETGELQPDHIVTPGAVIDHIIVSQ 217 +T+VE +E+V G L P+ IVTPG +D II S+ Sbjct: 185 VTIVEVEEIVPAGTLDPEMIVTPGIFVDIIIESK 218 Lambda K H 0.320 0.140 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 184 Number of extensions: 10 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 220 Length of database: 227 Length adjustment: 22 Effective length of query: 198 Effective length of database: 205 Effective search space: 40590 Effective search space used: 40590 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory