GapMind for catabolism of small carbon sources

 

Alignments for a candidate for PCBD in Bacillus alkalinitrilicus DSM 22532

Align Putative pterin-4-alpha-carbinolamine dehydratase; PHS; EC 4.2.1.96; 4-alpha-hydroxy-tetrahydropterin dehydratase; Pterin carbinolamine dehydratase; PCD (uncharacterized)
to candidate WP_078427800.1 BK574_RS05195 pterin-4-alpha-carbinolamine dehydratase

Query= curated2:Q96YL0
         (93 letters)



>NCBI__GCF_002019605.1:WP_078427800.1
          Length = 108

 Score = 67.4 bits (163), Expect = 4e-17
 Identities = 33/92 (35%), Positives = 55/92 (59%), Gaps = 1/92 (1%)

Query: 1   MKKLTEKEIREELNKMKGWSLKGNV-IEKTFLFHDFKEAVNFLNKVQPIADSMNHHPDVC 59
           ++KLT +EI   LN  K W L     IEK + FH + + + F+ K+  +++ MNHHP + 
Sbjct: 10  VEKLTVQEIEIFLNTYKDWKLVDEKWIEKKYRFHAYLDGIEFVQKIAQVSEEMNHHPFIS 69

Query: 60  IYYNKVIVQLTTHDAGGITDLDVELAKKIDEL 91
           I Y  + V+L++    G+T LD +LA++ D +
Sbjct: 70  IDYKLIRVKLSSWKENGLTALDTKLAEEYDAI 101


Lambda     K      H
   0.318    0.136    0.393 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 28
Number of extensions: 2
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 93
Length of database: 108
Length adjustment: 11
Effective length of query: 82
Effective length of database: 97
Effective search space:     7954
Effective search space used:     7954
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 39 (20.8 bits)
S2: 39 (19.6 bits)

This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory