Align Enoyl-CoA hydratase ACTT3; ACT-toxin biosynthesis protein 3; EC 4.2.1.17 (characterized)
to candidate WP_078428393.1 BK574_RS09185 enoyl-CoA hydratase
Query= SwissProt::Q589W8 (296 letters) >NCBI__GCF_002019605.1:WP_078428393.1 Length = 279 Score = 204 bits (519), Expect = 2e-57 Identities = 115/252 (45%), Positives = 156/252 (61%), Gaps = 8/252 (3%) Query: 23 DGIAVIVLARSQSRNALTLPMLTDMVQLLSAMDADDSVKCIVFTGEGQFFCSGVDLTEGF 82 D I I L RS NA ML +M+ L D+DD+V+ I+ TGEG+ FC+G DL G Sbjct: 11 DHIMTITLHRSDRMNAFNTQMLEEMLAALDQADSDDNVRAIIVTGEGRAFCAGADLDNGS 70 Query: 83 ----GEIGKTRDTHRDAGGKLALAIHNCRKPTIAAINGTAVGVGITMTLPMSIRIAAESA 138 GE+ +T + RD GG L+L I++ +KP IAAING AVGVGITMTLPM IRIA+ +A Sbjct: 71 QSFTGEVEETEE-FRDTGGILSLRIYDLKKPIIAAINGPAVGVGITMTLPMDIRIASTNA 129 Query: 139 KISFPFVRRGIVADAASSFYLPRLIGYGRALHLFTTGALYPAESGLLHGLFSETVNPASS 198 K+ F F RRGI +A S ++LPR++G +A TG ++PA+ L L S+ V+P Sbjct: 130 KMGFVFCRRGIAPEACSGWFLPRVVGISKATEWVLTGRVFPAQEALDSRLVSQVVSP-EE 188 Query: 199 TLPRALEVARDIAVNASQVGVYLTRDLIYRSLRS--PEQAHLLESATLYTRYQSQDFEEG 256 LP A +A+DIA N S V L+R L++R L + P +H +ES ++ D +EG Sbjct: 189 LLPTARAIAKDIAENTSATSVALSRQLLWRMLGADHPRTSHAIESKMIHWSSAEADAKEG 248 Query: 257 VKSFLEKRRPRF 268 V SF EKR+P F Sbjct: 249 VASFFEKRKPEF 260 Lambda K H 0.320 0.135 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 207 Number of extensions: 13 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 296 Length of database: 279 Length adjustment: 26 Effective length of query: 270 Effective length of database: 253 Effective search space: 68310 Effective search space used: 68310 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory