Align Putative pterin-4-alpha-carbinolamine dehydratase; PHS; EC 4.2.1.96; 4-alpha-hydroxy-tetrahydropterin dehydratase; Pterin carbinolamine dehydratase; PCD (uncharacterized)
to candidate WP_078429263.1 BK574_RS15760 hypothetical protein
Query= curated2:Q8DHW8 (95 letters) >NCBI__GCF_002019605.1:WP_078429263.1 Length = 109 Score = 50.4 bits (119), Expect = 5e-12 Identities = 27/84 (32%), Positives = 47/84 (55%), Gaps = 1/84 (1%) Query: 10 IEAQLANLPGWKQVGDR-LEQTFTFKDFLGSIAFVNRLVDPAEQAGHHPDLSISWNRVTV 68 I + + GW VG+ + + F+F F + FV + +Q H+P +SI+ V + Sbjct: 9 IVTHITKITGWTHVGNHAIIKNFSFPSFEKTGQFVYLVTKIMDQEKHYPQISITDFNVQI 68 Query: 69 CLTTHDVGGITQKDIDLAKVISNL 92 LTT+DV G+T KD+ +A+ I+ + Sbjct: 69 SLTTYDVEGVTGKDLVMAQKINRI 92 Lambda K H 0.320 0.135 0.406 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 31 Number of extensions: 4 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 95 Length of database: 109 Length adjustment: 11 Effective length of query: 84 Effective length of database: 98 Effective search space: 8232 Effective search space used: 8232 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.3 bits) S2: 40 (20.0 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory