Align ABC transporter ATP-binding protein (characterized, see rationale)
to candidate WP_078715619.1 B5D49_RS00080 ABC transporter ATP-binding protein
Query= uniprot:A0A165KC86 (260 letters) >NCBI__GCF_900167125.1:WP_078715619.1 Length = 263 Score = 246 bits (629), Expect = 3e-70 Identities = 129/257 (50%), Positives = 175/257 (68%), Gaps = 6/257 (2%) Query: 6 NEVVLKVAGISKRFGGLQALSDVGITIKRGQVYGLIGPNGAGKTTFFNVITGLYTPDAGT 65 N+ L V G+ FGGL+AL+ V + +++G++ LIGPNGAGKTTFFN ITG+Y P G Sbjct: 2 NKPALDVRGLCMDFGGLRALNKVDLEVRQGEIAALIGPNGAGKTTFFNCITGIYAPTEGD 61 Query: 66 FELAGKPYEPTAVH-----EVAKAGIARTFQNIRLFAEMTALENVMVGRHIRTGSGLFGA 120 + ++ V + G+ARTFQNIRLF MT LENVM+GRH R S + GA Sbjct: 62 IHVLPDGENRVRINGRKPNHVTELGMARTFQNIRLFPSMTVLENVMIGRHCRNRSSILGA 121 Query: 121 VFRTKGFKAEEAAIAKRAQELLDYVGIGKFADYKARTLSYGDQRRLEIARALATDPQLIA 180 V R + +E + R+ E+L+ VG+ ++A+ A L YG QRRLEIARA+AT+P L+ Sbjct: 122 VLRDGHTRRQEDEVISRSYEMLELVGLERWANELATNLPYGAQRRLEIARAMATEPFLLL 181 Query: 181 LDEPAAGMNATEKVQLRELIDRIRND-NRTILLIEHDVKLVMGLCDRVTVLDYGKQIAEG 239 LDEPAAGMN E +L++LID IR + +LLIEHD+K+VM + DR+ V+DYG++IA G Sbjct: 182 LDEPAAGMNPQETRRLKDLIDHIRETYHIAVLLIEHDMKMVMSVSDRIYVMDYGQRIAAG 241 Query: 240 NPAEVQKNEKVIEAYLG 256 +P EV KN +VI+AYLG Sbjct: 242 SPEEVSKNPEVIKAYLG 258 Lambda K H 0.319 0.137 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 211 Number of extensions: 6 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 263 Length adjustment: 25 Effective length of query: 235 Effective length of database: 238 Effective search space: 55930 Effective search space used: 55930 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory