Align high-affinity branched-chain amino acid ABC transporter, ATP-binding protein LivF (characterized)
to candidate WP_078716397.1 B5D49_RS04235 ABC transporter ATP-binding protein
Query= CharProtDB::CH_003736 (237 letters) >NCBI__GCF_900167125.1:WP_078716397.1 Length = 240 Score = 261 bits (667), Expect = 9e-75 Identities = 135/236 (57%), Positives = 176/236 (74%), Gaps = 2/236 (0%) Query: 3 KVMLSFDKVSAHYGKIQALHEVSLHINQGEIVTLIGANGAGKTTLLGTLCGDPRATSGRI 62 + +L +V+AHYG+IQAL +SL + +GE+V++IGANGAGK+T L T+CG RA+ G + Sbjct: 4 ETILELKEVAAHYGRIQALKGISLSVREGEVVSIIGANGAGKSTTLMTICGIVRASQGTV 63 Query: 63 VFDDKDITDWQTAKIMREAVAIVPEGRRVFSRMTVEENLAMGGFF-AERDQFQERIKWVY 121 + +DIT K+ R + VPEGRR+F R++V ENL MG FF + + +E + VY Sbjct: 64 WYQGRDITRINADKLPRMGLCQVPEGRRIFPRLSVAENLDMGAFFRRSKRRIREDTEMVY 123 Query: 122 ELFPRLHERRIQRAGTMSGGEQQMLAIGRALMSNPRLLLLDEPSLGLAPIIIQQIFDTIE 181 + FPRL ERR Q GT+SGGEQQMLAIGRALMS PRLLLLDEPSLGLAP+I+QQIFD ++ Sbjct: 124 DYFPRLRERRNQAGGTLSGGEQQMLAIGRALMSRPRLLLLDEPSLGLAPLIVQQIFDIVQ 183 Query: 182 QL-REQGMTIFLVEQNANQALKLADRGYVLENGHVVLSDTGDALLANEAVRSAYLG 236 + +EQG+TI LVEQNAN AL+ ++RGYVLE G VV++D ALL N +R AYLG Sbjct: 184 TINKEQGVTILLVEQNANLALQASNRGYVLETGDVVMADDAAALLDNPDIRKAYLG 239 Lambda K H 0.321 0.137 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 215 Number of extensions: 13 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 237 Length of database: 240 Length adjustment: 23 Effective length of query: 214 Effective length of database: 217 Effective search space: 46438 Effective search space used: 46438 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory