Align Branched chain amino acid ABC transporter substrate-binding protein (characterized, see rationale)
to candidate WP_078716432.1 B5D49_RS04220 branched-chain amino acid ABC transporter substrate-binding protein
Query= uniprot:A0A165KTD4 (375 letters) >NCBI__GCF_900167125.1:WP_078716432.1 Length = 388 Score = 172 bits (435), Expect = 2e-47 Identities = 120/367 (32%), Positives = 181/367 (49%), Gaps = 20/367 (5%) Query: 14 AAAAGVASAQEQVVKIGHVAPVSGAQAHYGKDNENGARMAIEELNAQGVTIGGKKIKFEL 73 AA+AG A V+KIG ++P++G + G D NG R AI+ + AQG G I L Sbjct: 26 AASAGQAEEALPVLKIGSISPLTGPYSADGNDIANGVRAAIDVIKAQGGLEGFSDIV--L 83 Query: 74 VAEDDAADPKQGTAAAQKLCDAKVAGVVGHLNSGTTIPASKVYNDCGIPHVTGAATNPNL 133 AED A DPKQ AAA KL +V GVVG S +TIPAS + GI VT +T+P + Sbjct: 84 FAEDTACDPKQAVAAANKLISEEVVGVVGAYCSSSTIPASATLDPEGIFTVTPGSTSPKV 143 Query: 134 TKPGYKTTFRIIANDNALGAGLAFYAVDTLKLKTVAIIDDRTAYGQGVADVFKKTATAKG 193 T+ G + FRI D+ + D L+ KT+ I+DD+T Y QG+AD G Sbjct: 144 TERGLQHMFRICGRDDHQAPAAVKFMTDYLEAKTIFIVDDKTTYSQGLADEVAMNCEKVG 203 Query: 194 MKVVDEQFTTDKATDFMAILTAIKAKNPDAIFYGGM--DPQGGPMLRQMEQLGMGNVKYF 251 ++V+ D+ A+LT ++ NPD +FY + G ML Q +++G+ + Sbjct: 204 IEVLAHDHVNQGDKDYSAVLTKVRQANPD-VFYISLQNSATGALMLLQAKRMGI-EAQCM 261 Query: 252 GGDGICTSEIAKLAAGAKTLGNVICAEGGSSLAKMPGGTAWKAKY----DAKYPNQFQVY 307 G D + ++ ++A A AEG T K +A+Y + Y Sbjct: 262 GQDAVFHPQLIEIAKEA--------AEGACLTFGYTDTTTDTYKVFQEANAEY-GKVGAY 312 Query: 308 SPYTYDATFLIVDAMKRANSVDPKVYTPELAKSSFKGVTSTIAFEPNGEMKNPAITLYVY 367 S Y YD+ + +A++ A S DP + + F+G + + F+PNG+ + + V Sbjct: 313 SAYAYDSAMCLFNAIRAAGSTDPAKVRAAMLELDFQGASKRVKFQPNGDSGSDYVVFKV- 371 Query: 368 KDGKKTP 374 +GK P Sbjct: 372 MEGKLVP 378 Lambda K H 0.315 0.131 0.375 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 338 Number of extensions: 15 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 375 Length of database: 388 Length adjustment: 30 Effective length of query: 345 Effective length of database: 358 Effective search space: 123510 Effective search space used: 123510 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory