Align ABC transporter ATP-binding protein (characterized, see rationale)
to candidate WP_081434168.1 AZC_RS23125 ABC transporter ATP-binding protein
Query= uniprot:A0A165KC86 (260 letters) >NCBI__GCF_000010525.1:WP_081434168.1 Length = 258 Score = 184 bits (468), Expect = 1e-51 Identities = 102/253 (40%), Positives = 152/253 (60%), Gaps = 7/253 (2%) Query: 9 VLKVAGISKRFGGLQALSDVGITIKRGQVYGLIGPNGAGKTTFFNVITGLYTPDAGTFEL 68 +++ +G++K F G A+ +V + I+R ++ LIGPNGAGKTT FN+IT P GT L Sbjct: 11 IVEASGLTKEFKGFTAVKNVNLRIRRNTIHALIGPNGAGKTTCFNLITKFLEPTRGTIRL 70 Query: 69 AGKPYEPTAVHEVAKAGIARTFQNIRLFAEMTALENVMVGRHIRTGSGLFGAVFRTKGFK 128 G+ T +VA+ G+ R+FQ F +T LENV V + G+ F + Sbjct: 71 NGRDITRTKPADVARLGMVRSFQISATFGHLTVLENVRVALQRKLGTS-----FHFWASE 125 Query: 129 AEEAAIAKRAQELLDYVGIGKFADYKARTLSYGDQRRLEIARALATDPQLIALDEPAAGM 188 A+ RA ELL+ VG+ +A + A L YG +R LEIA LA DP+++ LDEP +GM Sbjct: 126 TSLDALNDRAMELLEEVGLSSYARHLAVELPYGRKRALEIATTLALDPEMLLLDEPTSGM 185 Query: 189 NATEKVQLRELIDRIRNDNRTILLIEHDVKLVMGLCDRVTVLDYGKQIAEGNPAEVQKNE 248 + + +LI R+ + RT+L++EH++ +V L D +TVL G+ + EG +EV KN Sbjct: 186 GREDIARTADLIKRV-SAQRTVLMVEHNLSVVADLSDTITVLARGEILTEGPYSEVSKNP 244 Query: 249 KVIEAYLGTG-GH 260 +V+EAY+GTG GH Sbjct: 245 QVVEAYMGTGHGH 257 Lambda K H 0.319 0.137 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 186 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 258 Length adjustment: 24 Effective length of query: 236 Effective length of database: 234 Effective search space: 55224 Effective search space used: 55224 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory