Align Glucokinase; EC 2.7.1.2; Glucose kinase (uncharacterized)
to candidate WP_081495339.1 LFE_RS04280 glucokinase
Query= curated2:B2J224 (341 letters) >NCBI__GCF_000284315.1:WP_081495339.1 Length = 400 Score = 197 bits (501), Expect = 4e-55 Identities = 120/348 (34%), Positives = 185/348 (53%), Gaps = 22/348 (6%) Query: 3 LLLAGDIGGTKTIL---QLVETSDSQGLHTIYQESYHSADFPDLVPIVQQFLI-----KA 54 L+L GDIGGTKT L L E + + Y S + L P++Q++L Sbjct: 55 LVLVGDIGGTKTSLALFSLAERGSREHFVPLCPAVYPSKRYDSLEPMIQEYLSWVRERLV 114 Query: 55 NTPIPEKACFAIAGPIVKNTAKLTNLAWFLDTERLQQELGIP--HIYLINDFAAVGYGIS 112 P A F +AGP+ + TNL W +D L++ + + ++ L+ND A+ + + Sbjct: 115 GDPNIVAATFGVAGPVTGRVCRTTNLPWIVDAGSLEKLISVQEGNVNLLNDLEALAWSVG 174 Query: 113 GLQKQDLHPLQVGKPQPETPIGIIGAGTGLGQGFLIKQGNNYQVFPSEGGHADFAPRNEI 172 G L +Q G+P T + ++ GTGLG+ L + N+ PSEGGHAD+AP N+ Sbjct: 175 GDPLIPLATIQEGEPGTSTTMVLVAPGTGLGEAVLCGRDENFFALPSEGGHADWAPVNKE 234 Query: 173 EFQLLKYLLDKHDIQRISVERVVSGMGIVAIYQFLRDRKFAAESPDIAQIVRTWEQEAGQ 232 + +LL+YL + + +SVERV+SGMGIV +Y FL A P + Sbjct: 235 QARLLEYLWE--EFSHVSVERVLSGMGIVRLYTFLAKDIPAPNRP----------LPIPK 282 Query: 233 EEKSVDPGAAIGTAALEKRDRLSEQTLQLFIEAYGAEAGNLALKLLPYGGLYIAGGIAPK 292 E D + I AL+++D + + L++F E EA N+ LK+L GG +I GGI + Sbjct: 283 AEPPADFPSQISQKALDEKDPVCMKALEMFAEILAQEASNMVLKVLARGGCFIGGGIPIR 342 Query: 293 ILPLIQNSGFLLNFTQKGRMRPLLEEIPVYIILNPQVGLIGAALCAAR 340 I P +++ F F +KGR LL ++PV+IIL+P+ L+G+A A+R Sbjct: 343 IRPFLESVAFRRRFVEKGRYSELLAKVPVWIILDPEAPLVGSAFYASR 390 Lambda K H 0.320 0.140 0.408 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 320 Number of extensions: 18 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 341 Length of database: 400 Length adjustment: 30 Effective length of query: 311 Effective length of database: 370 Effective search space: 115070 Effective search space used: 115070 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
Align candidate WP_081495339.1 LFE_RS04280 (glucokinase)
to HMM TIGR00749 (glk: glucokinase (EC 2.7.1.2))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR00749.hmm # target sequence database: /tmp/gapView.3696649.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00749 [M=315] Accession: TIGR00749 Description: glk: glucokinase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.7e-77 246.7 0.0 2.1e-77 246.5 0.0 1.1 1 NCBI__GCF_000284315.1:WP_081495339.1 Domain annotation for each sequence (and alignments): >> NCBI__GCF_000284315.1:WP_081495339.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 246.5 0.0 2.1e-77 2.1e-77 1 315 [] 57 385 .. 57 385 .. 0.94 Alignments for each domain: == domain 1 score: 246.5 bits; conditional E-value: 2.1e-77 TIGR00749 1 lvgdiGGtnarlalvevapgeieqv......ktyssedfpsleavvrvyleeakvel.kdpi..kgcfaiatP 64 lvgdiGGt++ lal a + + +y s+ ++sle++++ yl+ ++ l +dp ++f +a+P NCBI__GCF_000284315.1:WP_081495339.1 57 LVGDIGGTKTSLALFSLAERGSREHfvplcpAVYPSKRYDSLEPMIQEYLSWVRERLvGDPNivAATFGVAGP 129 89*************8888777665567889********************999875267644699******* PP TIGR00749 65 iigdfvrltnldWalsieelkqelala..klelindfaavayailalkeedliqlggakveesaaiailGaGt 135 ++g ++r tnl W + l++ ++++ +++l+nd+ a a+++ + l+ ++ ++ +s+++ ++ +Gt NCBI__GCF_000284315.1:WP_081495339.1 130 VTGRVCRTTNLPWIVDAGSLEKLISVQegNVNLLNDLEALAWSVGGDPLIPLATIQEGEPGTSTTMVLVAPGT 202 ************************99834699**************9999*********************** PP TIGR00749 136 GlGvatliqqsdgrykvlageGghvdfaPrseleillleylrkkygrvsaervlsGsGlvliyealskrkger 208 GlG a l d+++ +l++eGgh+d+aP +++++ lleyl +++++vs+ervlsG+G+v +y +l k + NCBI__GCF_000284315.1:WP_081495339.1 203 GLGEAVLCG-RDENFFALPSEGGHADWAPVNKEQARLLEYLWEEFSHVSVERVLSGMGIVRLYTFLAKDIPAP 274 *****9998.899********************************************************9887 PP TIGR00749 209 e....vsklskeelkekdiseaalegsdvlarralelflsilGalagnlalklgarGGvyvaGGivPrfiell 277 + + k + +is++al+++d+++ +ale+f il ++a+n+ lk++arGG ++ GGi r+ ++l NCBI__GCF_000284315.1:WP_081495339.1 275 NrplpIPKAEPPADFPSQISQKALDEKDPVCMKALEMFAEILAQEASNMVLKVLARGGCFIGGGIPIRIRPFL 347 766777777777888999******************************************************* PP TIGR00749 278 kkssfraafedkGrlkellasiPvqvvlkkkvGllGag 315 ++ +fr +f +kGr+ ella++Pv ++l+ ++ l+G++ NCBI__GCF_000284315.1:WP_081495339.1 348 ESVAFRRRFVEKGRYSELLAKVPVWIILDPEAPLVGSA 385 ***********************************986 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (315 nodes) Target sequences: 1 (400 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 19.86 // [ok]
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory