Align CVE1 aka ChvE aka ATU2348 aka AGR_C_4267, component of Multiple sugar (arabinose, xylose, galactose, glucose, fucose) putative porter (characterized)
to candidate WP_082239850.1 RHE_RS23995 ABC transporter substrate-binding protein
Query= TCDB::P25548 (354 letters) >NCBI__GCF_000092045.1:WP_082239850.1 Length = 354 Score = 126 bits (317), Expect = 8e-34 Identities = 101/333 (30%), Positives = 158/333 (47%), Gaps = 36/333 (10%) Query: 22 AFAQDK---GSVGIAMPTKSSARWID-DGNNIVKQLQE--AGYKTDLQYADDDIPNQLSQ 75 AFAQ K +V MP + S R+ + D V ++++ A K Q AD DI Q Q Sbjct: 23 AFAQSKVADATVAFLMPDQGSTRYEEHDHPGFVAEMKKLCASCKVIYQNADADIAKQQQQ 82 Query: 76 IENMVTKGVKVLVIASIDGTTLSDVLKQAGEQGIKVIAYDRLIRNSGDVSYYATFDNFQV 135 + +T+G KV+V+ +D + +++ A QG+KVIAYDR I G +Y +FDN + Sbjct: 83 FNSAITQGAKVIVLDPVDSAAAASLVQLAQSQGVKVIAYDRPI-PKGKADFYVSFDNKAI 141 Query: 136 GVLQATSITDKLGLK----DGKGPFNIELFGGSPDDNNAFFFYDGAMSVLKPYIDSGKLV 191 G A S+ L K DG G I GSP D A ++K I G + Sbjct: 142 GKAIAESLVQHLKAKGVPTDGGGILQI---NGSPT--------DAAAGLIKDGIHEG--L 188 Query: 192 VKSGQMGMDKVGTLRWDPATAQARMDNLLSAYYTDAKVDAVLSPYDGLSIGIISSLKGVG 251 G + + T W PA AQ ++ + ++ V++ DG G I++ K G Sbjct: 189 ASGGYKTLAEYDTPNWQPANAQQWAAGQITRF--GKQIVGVVAANDGTGGGAIAAFKAAG 246 Query: 252 YGTKDQPLPVVSGQDAEVPSVKSIIAGEQYSTIFKDTRELAKVTVNMVNAVMEGKEPEVN 311 P+P V+G DA + +++ II+G+QY+TI K + +A ++ ++ G Sbjct: 247 V----DPVPPVTGNDATIAALQLIISGDQYNTISKPSEIVAAAAADVAVKLLAG------ 296 Query: 312 DTKTYENGVKVVPSYLLKPVAVTKENYKQVLVD 344 +T E + P+ L P VT EN K ++D Sbjct: 297 ETVKAEMTLYDTPAKLFVPAVVTAENLKAEIID 329 Lambda K H 0.314 0.133 0.372 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 281 Number of extensions: 16 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 354 Length of database: 354 Length adjustment: 29 Effective length of query: 325 Effective length of database: 325 Effective search space: 105625 Effective search space used: 105625 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory