Align iron(III) dicitrate transport ATP-binding protein FecE (characterized)
to candidate WP_083492030.1 ABB28_RS12765 ABC transporter ATP-binding protein
Query= CharProtDB::CH_088321 (255 letters) >NCBI__GCF_001431535.1:WP_083492030.1 Length = 261 Score = 99.8 bits (247), Expect = 5e-26 Identities = 76/246 (30%), Positives = 123/246 (50%), Gaps = 17/246 (6%) Query: 3 LRTENLTVSYGTDKVLNDVSLSLPTGKITALIGPNGCGKSTLLNCFSRLLMPQSGTVFLG 62 + + +V G KVL+ +SL + G+ TAL+GPNGCGKST + +R L P + G Sbjct: 2 IELDRASVMRGQVKVLHGLSLRIAQGQHTALLGPNGCGKSTFIKLITRELYPLAHAD--G 59 Query: 63 DNPINMLSSRQ-----LARRLSL----LPQHHLTPEGITVQELVSYG--RNPWLSLWGRL 111 P+ +L + L +L + L + G+TV++ V G + L + + Sbjct: 60 HVPVKVLGQNRWQVDRLRSQLGIVTGDLSNNLADMPGLTVEQAVLTGFFASYVLPAFREI 119 Query: 112 SAE--DNARVNVAMNQTRINHLAVRRLTELSGGQRQRAFLAMVLAQNTPVVLLDEPTTYL 169 S + D AR +AM+ H R ELS G+ +R +A L +LLDEP+T L Sbjct: 120 SQDMRDRARATLAMSGALALH--GRTYAELSAGETRRVLIARALVNRPHALLLDEPSTGL 177 Query: 170 DINHQVDLMRLMGELRTQGKTVVAVLHDLNQASRYCDQLVVMANGHVMAQGTPEEVMTPG 229 D+ + L+ M L QG T+V V H + + +++V++ +G V+A GT E++ Sbjct: 178 DLVARQQLVDTMQSLARQGITLVLVTHHVEEIIPEIERVVLLRDGRVLADGTRAELLCDA 237 Query: 230 LLRTVF 235 L +F Sbjct: 238 PLSALF 243 Lambda K H 0.320 0.134 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 154 Number of extensions: 3 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 261 Length adjustment: 24 Effective length of query: 231 Effective length of database: 237 Effective search space: 54747 Effective search space used: 54747 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory