Align NatA, component of The neutral amino acid permease, N-1 (transports pro, phe, leu, gly, ala, ser, gln and his, but gln and his are not transported via NatB) (characterized)
to candidate WP_083492030.1 ABB28_RS12765 ABC transporter ATP-binding protein
Query= TCDB::Q7A2H0 (260 letters) >NCBI__GCF_001431535.1:WP_083492030.1 Length = 261 Score = 80.9 bits (198), Expect = 2e-20 Identities = 66/236 (27%), Positives = 113/236 (47%), Gaps = 24/236 (10%) Query: 22 GGIKAVQEARIEVAQGSITGLIGPNGAGKTTLFNLLSNFIRPDKGRVIFDGE-PIQQLQP 80 G +K + + +AQG T L+GPNG GK+T L++ + P DG P++ L Sbjct: 12 GQVKVLHGLSLRIAQGQHTALLGPNGCGKSTFIKLITRELYP---LAHADGHVPVKVLGQ 68 Query: 81 HQIAQQGMVRTFQVARTLSRLSVLENML---------LAAQKQTGENFWQVQLQPQVVVK 131 ++ +QV R S+L ++ L L ++ F+ + P Sbjct: 69 NR---------WQVDRLRSQLGIVTGDLSNNLADMPGLTVEQAVLTGFFASYVLPAFREI 119 Query: 132 EEKQLQEQAMFLLESVGLAKKAYEYAGGLSGGQRKLLEMGRALMTNPKLILLDEPAAGVN 191 + L S LA YA LS G+ + + + RAL+ P +LLDEP+ G++ Sbjct: 120 SQDMRDRARATLAMSGALALHGRTYA-ELSAGETRRVLIARALVNRPHALLLDEPSTGLD 178 Query: 192 PRLIDDICDRILTWNRQDGMTFLIIEHNMDVIMSLCDRVWVLAEGQNLADGTPAEI 247 + D + + RQ G+T +++ H+++ I+ +RV +L +G+ LADGT AE+ Sbjct: 179 LVARQQLVDTMQSLARQ-GITLVLVTHHVEEIIPEIERVVLLRDGRVLADGTRAEL 233 Lambda K H 0.319 0.136 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 131 Number of extensions: 8 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 261 Length adjustment: 25 Effective length of query: 235 Effective length of database: 236 Effective search space: 55460 Effective search space used: 55460 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory