Align Probable enoyl-CoA hydratase; EC 4.2.1.17 (uncharacterized)
to candidate WP_083509352.1 APY04_RS00020 enoyl-CoA hydratase/isomerase family protein
Query= curated2:P24162 (257 letters) >NCBI__GCF_001541235.1:WP_083509352.1 Length = 410 Score = 80.9 bits (198), Expect = 4e-20 Identities = 61/198 (30%), Positives = 96/198 (48%), Gaps = 15/198 (7%) Query: 6 IRYEISEGLAVITLDRPEVMNALNAAMRHELTAALHRARGEARA---IVLTGSGRAFCSG 62 +R E+ AVI+L+RP +NAL+ MR +L A + + + I+ + S RAF +G Sbjct: 58 LRVELQGSCAVISLNRPRALNALSLNMRTKLAEAFPKFARDPQVYCCIIQSASDRAFSAG 117 Query: 63 QDLGDGAAEGLN----LETVLREEYEPLLQAIYSC-PLPVLAAVNGAAAGAGANLALAAD 117 D+ + A REEY L ++ C P ++ ++GA G+G ++L Sbjct: 118 GDVREIVAMARQDLPAARQAFREEYS--LNWLHECFSKPTVSLIDGAVMGSGVGISLFGT 175 Query: 118 VVIAAQSAAFMQAFTRIGLMPDAGGTWWLPRQVGMARAMGM--ALFAEKIGAEEAARMGL 175 +A + F T IGL PD G +W L R M ++GM L IGA +A +GL Sbjct: 176 HRVAGERYRFAMPETAIGLFPDVGVSWALAR---MPNSIGMYLGLTGRTIGAADAYALGL 232 Query: 176 IWEAVPDVDFEHHWRARA 193 + +P F+ +A A Sbjct: 233 LTHCIPAARFDEIRQALA 250 Lambda K H 0.321 0.133 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 216 Number of extensions: 12 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 257 Length of database: 410 Length adjustment: 28 Effective length of query: 229 Effective length of database: 382 Effective search space: 87478 Effective search space used: 87478 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory