Align 2,3-dehydroadipyl-CoA hydratase (EC 4.2.1.17) (characterized)
to candidate WP_083769199.1 AFER_RS03000 hypothetical protein
Query= metacyc::MONOMER-15953 (257 letters) >NCBI__GCF_000023265.1:WP_083769199.1 Length = 291 Score = 109 bits (273), Expect = 6e-29 Identities = 82/252 (32%), Positives = 115/252 (45%), Gaps = 16/252 (6%) Query: 6 SVDAPEQGVRLITLQRPEALNALNTQLLDELAAELALAEQDAETRAVVLTGSRKAFAAGA 65 S+DAP GV I L RPE NALN L LA D R VV+ G+ F AGA Sbjct: 33 SIDAPT-GVASIVLDRPERRNALNLTLWRRLAEVAREVAADPAVRVVVIEGAGGHFCAGA 91 Query: 66 DIKEMAER---DLVGILEDPRVAHWQRIAAFSKPLIAAVNGFCLGGGCELAMHADILIAG 122 D+ E + + + A I A S P +A V G CLGGG +A+ AD+++A Sbjct: 92 DVSEFGDARVGEATLTYDAATEAAAAAIEAISVPTVALVEGACLGGGVSIALAADVVLAA 151 Query: 123 EDARFGQPEINLGIMPGAGGTQRLLRAVGKSLAMQMVLSGQAIDARHAQRAGLVSEVTLP 182 ARFG P +LG + G RL+R VG A ++L + I A A GL V Sbjct: 152 ASARFGVPAASLGTLYPEGALGRLVRRVGDRRARWLLLGAERIGAVEAVTIGLAERV--- 208 Query: 183 ELTIERALAIARVIAQKAPLAVRLAKEALLKAEDTDLASGLRFERHAFTVLAGTADRAEG 242 ++ + ++ Q A L+ ++ + + + R ++ D AEG Sbjct: 209 ---VDDRASGYELVVQMATLS------SMTQQATKRVLADQRVHGELARIVFAAQDYAEG 259 Query: 243 IRAFQEKRRPEF 254 RAF E+R P F Sbjct: 260 RRAFGERRAPRF 271 Lambda K H 0.320 0.134 0.374 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 181 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 257 Length of database: 291 Length adjustment: 25 Effective length of query: 232 Effective length of database: 266 Effective search space: 61712 Effective search space used: 61712 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory