Align enoyl-CoA hydratase (EC 4.2.1.17) (characterized)
to candidate WP_083769333.1 AFER_RS07070 hypothetical protein
Query= BRENDA::P76082 (255 letters) >NCBI__GCF_000023265.1:WP_083769333.1 Length = 269 Score = 126 bits (316), Expect = 5e-34 Identities = 91/256 (35%), Positives = 128/256 (50%), Gaps = 6/256 (2%) Query: 3 ELIVS-RQQRVLLLTLNRPAARNALNNALLMQLVNELEAAATDTSISVCVITGNARFFAA 61 EL+V R+ V + LNRP RNA L+ L EA VI G R F+A Sbjct: 17 ELVVDERRDGVAWVWLNRPGQRNATTGPLVEALG---EALRRTEGARAVVIGGVGRTFSA 73 Query: 62 GADLNEMA--EKDLAATLNDTRPQLWARLQAFNKPLIAAVNGYALGAGCELALLCDVVVA 119 G DL E+ D L T L+ +L++ + P IAA++G ALG G +AL CD+VVA Sbjct: 74 GRDLTEIDPDHDDAEGVLAGTYHPLFEQLRSLSAPTIAAIHGAALGTGLGIALACDLVVA 133 Query: 120 GENARFGLPEITLGIMPGAGGTQRLIRSVGKSLASKMVLSGESITAQQAQQAGLVSDVFP 179 + R G P LG P +G + L R +G+ A ++ +GE + A + A LVS V Sbjct: 134 ARSCRLGSPFARLGAAPDSGAHEALWRVLGRWRAMWLIATGELLPADDPRVAPLVSLVVD 193 Query: 180 SDLTLEYALQLASKMARHSPLALQAAKQALRQSQEVALQAGLAQERQLFTLLAATEDRHE 239 + LA+++A AL A++ + + GLA E L LA T+D HE Sbjct: 194 DETFERAVADLAARVASGPTQALLASRALFEELGGEGRRRGLAAEAHLQGQLAGTDDFHE 253 Query: 240 GISAFLQKRTPDFKGR 255 G+ AF ++R P F GR Sbjct: 254 GMRAFQERRDPRFIGR 269 Lambda K H 0.318 0.130 0.356 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 113 Number of extensions: 4 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 269 Length adjustment: 25 Effective length of query: 230 Effective length of database: 244 Effective search space: 56120 Effective search space used: 56120 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory