Align L-glutamate gamma-semialdehyde dehydrogenase (EC 1.2.1.88) (characterized)
to candidate WP_083831993.1 AZO_RS11360 aldehyde dehydrogenase
Query= BRENDA::Q9K9B2 (515 letters) >NCBI__GCF_000061505.1:WP_083831993.1 Length = 478 Score = 231 bits (590), Expect = 3e-65 Identities = 154/489 (31%), Positives = 247/489 (50%), Gaps = 27/489 (5%) Query: 33 LGKEYPLIINGERVTTEDKIQSWNPARKDQLVGSVSKANQDLAEKAIQSADEAFQT--WR 90 +G E+ ++GE + D PA Q +V ++A+ +A AF++ W Sbjct: 3 IGAEWSAAVSGETLAVLD------PAT-GQAFATVPAGGAADIDRAVAAARRAFESGEWP 55 Query: 91 NVNPEERANILVKAAAIIRRRKHEFSAWLVHEAGKPWKEA-DADTAEAIDFLEYYARQMI 149 + P +R +L+K A +I E + + GKP A D A +DFL Y A Sbjct: 56 KMRPVDRERLLLKFADLIEANAQELAEIEALDNGKPVMMARHVDVALVVDFLRYMAGWAT 115 Query: 150 ELNRGKEILSRPGEQNRYFY-----TPMGVTVTISPWNFALAIMVGTAVAPIVT-GNTVV 203 ++ +S P ++R + P+GV I PWNF L +M V P +T G T+V Sbjct: 116 KIEGSTMDVSVPLMRDRELFGFTRREPVGVVGAIIPWNFPL-LMAAWKVGPALTSGCTMV 174 Query: 204 LKPASTTPVVAAKFVEVLEDAGLPKGVINYVPGSGAEVGDYLVDHPKTSLITFTGSKDVG 263 LKPA TP+ A +F E+ +AG P GV+N V G G G L H + FTGS ++G Sbjct: 175 LKPAEETPLTALRFAELALEAGYPAGVLNVVTGHGDTAGAALASHKGIEKVAFTGSTEIG 234 Query: 264 VRLYERAAVVRPGQNHLKRVIVEMGGKDTVVVDRDADLDLAAESILVSAFGFSGQKCSAG 323 +L +AA+ +++ RV +E+GGK V+V DAD +AA + F GQ C+AG Sbjct: 235 -KLVGKAAI-----DNMTRVSLELGGKSPVIVLDDADPAMAAAGAAQAIFFNQGQVCTAG 288 Query: 324 SRAVIHKDVYDEVLEKTVALAKNLTVGDPTNRDNYMGPVIDEKAFEKIMSYIEIGKKEG- 382 SR IHK +++V+E +A ++ +G + +GP++ ++++ YIE G EG Sbjct: 289 SRLFIHKSRFEKVVEGLSGIAASMKLGPGIDPSTQIGPLVSAVQQQRVLGYIESGLAEGA 348 Query: 383 RLMTGGEGDSSTGFFIQPTIIADLDPEAVIMQEEIFGPVVAFSKANDFDHALEIANNTEY 442 R TGG G+F++PT++ + +++EEIFGPVV D D AN+T Y Sbjct: 349 RAATGGGAGGEAGYFVKPTVLVNAHDAMKVVREEIFGPVVVAMPYEDLDEVAHRANDTPY 408 Query: 443 GLTGAVITRNRAHIEQAKREFHVGNLYFNRNCTGAIVGYHPFGGFKMSGTDSKAGGPDYL 502 GL ++ + + + + + G ++ NC + PFGG+K SG + G L Sbjct: 409 GLAASIWSNDLTRVHRLIPKIKAGTVWV--NCHNILDNAMPFGGYKQSGIGREMGRA-VL 465 Query: 503 ALHMQAKTV 511 ++ ++K+V Sbjct: 466 DMYTESKSV 474 Lambda K H 0.316 0.134 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 602 Number of extensions: 34 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 515 Length of database: 478 Length adjustment: 34 Effective length of query: 481 Effective length of database: 444 Effective search space: 213564 Effective search space used: 213564 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory