Align 2-methylcitrate synthase (EC 2.3.3.5) (characterized)
to candidate WP_083917336.1 F612_RS0106990 citrate synthase
Query= BRENDA::Q8X694 (389 letters) >NCBI__GCF_000381085.1:WP_083917336.1 Length = 392 Score = 235 bits (600), Expect = 1e-66 Identities = 135/380 (35%), Positives = 213/380 (56%), Gaps = 17/380 (4%) Query: 22 LSGVPAGNTALCTVGKSGNDLHYRGYDILDLAEHCEFEEVAHLLIHGKLPTRDELAAYKT 81 L+GVPA + + + L YRGYDI +LAEH FEE LL+ G+LPT +ELA + T Sbjct: 7 LAGVPATESKISFIDGQKGILTYRGYDIQELAEHSSFEETTLLLLFGELPTAEELANFDT 66 Query: 82 KLKALRGLPANVRTVLEALPAASHPMDVMRTGVSALGCTLPEKEGHTVSGARDIAD---- 137 +L+ R + N+R +++ LP +HPM +++ V++L P E + GA + D Sbjct: 67 ELRNNRRVKYNIREIMKNLPPTTHPMHMLQVVVASLASFYPSTE--YMKGATENQDYINS 124 Query: 138 ---KLLASLSSILLYWYHYSHNGERIQPETDDDSIGGHFLHLLHGEKPSQSWEKAMHISL 194 K++A + +++ W H + + I P D + +FL+++ GE+P + W + + Sbjct: 125 VTVKIIAHMGTLVAMWEHMRNGYDPIPPRKDLN-YAENFLYMVTGEEPDKDWARLLDAIF 183 Query: 195 VLYAEHEFNASTFTSRVIAGTGSDMYSAIIGAIGALRGPKHGGANEVSLEIQQRYETPDE 254 +L+AEH NASTFT+ V T ++ S I AI +L GP HGGAN+ +E+ + P+ Sbjct: 184 ILHAEHTINASTFTTMVTGSTLANPCSVISSAIASLSGPLHGGANQKVIEMLEEIGAPEN 243 Query: 255 AEADIRKRVESKEVVIGFGHPVYTIADPRHQVIKRVAKQLSQEGGSLKM---YNIADRLE 311 A A I R+ V+ G GH Y DPR ++++++ L EG S K+ + A +E Sbjct: 244 ARAYIEDRLAKNRVIWGMGHREYKTKDPRASILQKLSSSL-LEGKSDKLSMAFQTALEVE 302 Query: 312 TVMWE---SKKMFPNLDWFSAVSYNMMGVPTEMFTPLFVIARVTGWAAHIIEQRQDNKII 368 V E K ++PN+D++S + Y MG +FTP+F +AR GW AH EQ Q+NKI Sbjct: 303 KVCEELLGHKGVYPNVDFYSGILYKEMGFDVGIFTPIFAVARSAGWMAHWREQLQNNKIF 362 Query: 369 RPSANYVGPEDRQFVALDKR 388 RP+ Y G D ++ ++ R Sbjct: 363 RPTQIYSGSGDLCYLPVELR 382 Lambda K H 0.317 0.133 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 377 Number of extensions: 18 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 389 Length of database: 392 Length adjustment: 31 Effective length of query: 358 Effective length of database: 361 Effective search space: 129238 Effective search space used: 129238 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory