Align Putative UDP-glucose 4-epimerase; EC 5.1.3.2; Galactowaldenase; UDP-galactose 4-epimerase (uncharacterized)
to candidate WP_083930393.1 METMI_RS0117890 hypothetical protein
Query= curated2:Q57664 (305 letters) >NCBI__GCF_000384075.1:WP_083930393.1 Length = 347 Score = 213 bits (543), Expect = 4e-60 Identities = 116/303 (38%), Positives = 173/303 (57%), Gaps = 8/303 (2%) Query: 3 LVTGGAGFIGSHIVDKLIENNYDVIILDNLTTGNKNNIN--PKAEFVNADI-RDKDLDEK 59 ++ GG GFIGSH+ D + +DV + D L++ +N+I + E ++ D +KDL Sbjct: 40 VIFGGGGFIGSHVTDAFVARGHDVRVFDRLSSDTRNHIGIPSQIEAIHGDFFNEKDL--A 97 Query: 60 INFKDVEVVIHQAAQINVRNSVENPVYDGDINVLGTINILEMMRKYDIDKIVFASSGGAV 119 + VEV +H +S EN YD N+ GT+ +L+ + KIVFASSGG V Sbjct: 98 LALSGVEVAVHLVTTTIPSSSNENMAYDVQTNLAGTLRMLDCALSAGVRKIVFASSGGTV 157 Query: 120 YGEPNYLPVDENHPINPLSPYGLSKYVGEEYIKLYNRLYGIEYAILRYSNVYGERQDPKG 179 YG P P+ ENHP PL YG++K E+Y++LY LYG+EY ILR +N +GERQ+P Sbjct: 158 YGRPTIFPIPENHPTEPLCSYGITKLAIEKYLQLYQHLYGLEYIILRLANPFGERQNPLS 217 Query: 180 EAGVISIFIDKMLKNQSPIIFGDGNQTRDFVYVGDVAKANLMALNW--KNEIVNIGTGKE 237 G ++ F+ K+ + S ++GDG+ RD+ YVGD+ A + A +++I NIG+G Sbjct: 218 GQGAVTTFLAKVAEGASVTVWGDGHVRRDYFYVGDLVSAFVKAAEQSPRSKIFNIGSGSS 277 Query: 238 TSVNELFDIIKHEIGFRGEAIYDKPREGEVYRIYLDIKKA-ESLGWKPEIDLKEGIKRVV 296 S+NEL II+ G + +Y R+ +V LD + A + LGW + + EGI R Sbjct: 278 LSINELLSIIRDVTGKNIDVVYSPSRKLDVPVNCLDTRLAGDELGWFRQTTITEGIARTW 337 Query: 297 NWM 299 WM Sbjct: 338 AWM 340 Lambda K H 0.317 0.140 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 286 Number of extensions: 8 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 305 Length of database: 347 Length adjustment: 28 Effective length of query: 277 Effective length of database: 319 Effective search space: 88363 Effective search space used: 88363 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory