Align ABC transporter ATP-binding protein-branched chain amino acid transport, component of The branched chain hydrophobic amino acid transporter, LivJFGHM (characterized)
to candidate WP_083931667.1 A3OQ_RS0109130 LPS export ABC transporter ATP-binding protein
Query= TCDB::Q8DQH8 (254 letters) >NCBI__GCF_000385335.1:WP_083931667.1 Length = 363 Score = 147 bits (370), Expect = 4e-40 Identities = 85/250 (34%), Positives = 138/250 (55%), Gaps = 18/250 (7%) Query: 3 LLEVKQLTKHFGGLTAVGDVTLELNEGELVGLIGPNGAGKTTLFNLLTGVYEPSEGTVTL 62 LL V+ L K + G V DV+LE+ GE +GL+GPNGAGKTT+F +++G+ P G + + Sbjct: 126 LLSVRHLRKIYKGRRVVEDVSLEVRRGEAIGLLGPNGAGKTTVFYMISGLVRPDVGAIEI 185 Query: 63 DGHLLNGKSPYKIASLGLGRTFQNIRLFKDLTVLDNVLIAFGNHHKQHVFTSFLRLPAFY 122 DGH + Y+ A LG+G Q +F+ L+V N+L Sbjct: 186 DGHDVTILPMYRRARLGIGYLPQEASVFRGLSVEQNILAVL----------------EIT 229 Query: 123 KSEKELKAKALE-LLKIFDLDGDAETLAKNLSYGQQRRLEIVRALATEPKILFLDEPAAG 181 + ++ +A LE LL+ FDL ++ A LS G++RR EI R+LA P + LDEP AG Sbjct: 230 QPDRRARAAELEGLLEEFDLARLRKSPAIALSGGERRRCEIARSLAGHPSFILLDEPFAG 289 Query: 182 MNPQETAELTELIRRIKDEFKITIMLIEHDMNLVMEVTERIYVLEYGRLIAQGTPDEIKT 241 ++P ++ L++ + I +++ +H++ + + +R Y++ G ++ +GTPDEI Sbjct: 290 VDPIAVGDIQSLVQHLTQR-GIGVLITDHNVRETLGLIDRAYIIHSGHVLTEGTPDEIVA 348 Query: 242 NKRVIEAYLG 251 + V YLG Sbjct: 349 DPDVRRLYLG 358 Lambda K H 0.319 0.139 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 234 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 254 Length of database: 363 Length adjustment: 27 Effective length of query: 227 Effective length of database: 336 Effective search space: 76272 Effective search space used: 76272 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory