Align acetyl-CoA C-acetyltransferase (EC 2.3.1.9) (characterized)
to candidate WP_084057170.1 B9A12_RS06945 acetyl-CoA C-acyltransferase
Query= BRENDA::P45359 (392 letters) >NCBI__GCF_900176285.1:WP_084057170.1 Length = 400 Score = 385 bits (990), Expect = e-112 Identities = 205/395 (51%), Positives = 274/395 (69%), Gaps = 5/395 (1%) Query: 2 KEVVIASAVRTAIGSYGKSLKDVPAVDLGATAIKEAVKKAGIK-PEDVNEVILGNVLQAG 60 ++VVI SA RT IG +G SLKDV A L A ++E +K+AG P ++EV+ G+ Q Sbjct: 5 RDVVIVSAARTPIGKFGGSLKDVRASSLLALVMEEVLKRAGNPDPAILDEVVTGDCAQCF 64 Query: 61 LGQNPARQASFKAGLPVEIPAMTINKVCGSGLRTVSLAAQIIKAGDADVIIAGGMENMSR 120 N AR A KAGLPVEIPA TI + C S ++ ++ A Q+I+A DA+V++ GG+E+MS Sbjct: 65 DEANTARTAMLKAGLPVEIPAHTIQRQCASSMQALAAATQMIRAEDAEVVLVGGVESMSS 124 Query: 121 APYLANNARWGYRMGNAKFVD---EMITDGLWDAFNDYHMGITAENIAERWNISREEQDE 177 APY ARWG R+ N + +D EM+ G N MG TAEN+A+++ I R+EQDE Sbjct: 125 APYYLPKARWGMRLMNHEVLDSVWEMLHSGSRLLGNPMIMGQTAENLAQKYGIDRQEQDE 184 Query: 178 FALASQKKAEEAIKSGQFKDEIVPVVIKGRKGETVV-DTDEHPRFGSTIEGLAKLKPAFK 236 AL S AE AIK G+FKDEIVPV I G KG+ V + DEHPRFG T++ L++LKP FK Sbjct: 185 VALRSHHNAEAAIKEGRFKDEIVPVEIPGPKGKVAVFEQDEHPRFGLTMDDLSRLKPVFK 244 Query: 237 KDGTVTAGNASGLNDCAAVLVIMSAEKAKELGVKPLAKIVSYGSAGVDPAIMGYGPFYAT 296 KDGTVTAGN+SGLND AA ++M+ KAKE+G++PLA+IV+ +AGV+P MGYGP AT Sbjct: 245 KDGTVTAGNSSGLNDGAAAALVMTRAKAKEMGLQPLARIVATAAAGVEPEYMGYGPVPAT 304 Query: 297 KAAIEKAGWTVDELDLIESNEAFAAQSLAVAKDLKFDMNKVNVNGGAIALGHPIGASGAR 356 + ++KAG T+ ++ LIE NEAFAAQ LA + + FD NVNG IALGHP+G +G R Sbjct: 305 EKVLKKAGMTLKDIQLIELNEAFAAQYLACERGIGFDRAIANVNGSGIALGHPVGCTGLR 364 Query: 357 ILVTLVHAMQKRDAKKGLATLCIGGGQGTAILLEK 391 I+++L + M +RD GLATLC+GGG G A ++ + Sbjct: 365 IVISLAYEMARRDLSVGLATLCVGGGMGMATIVAR 399 Lambda K H 0.315 0.132 0.375 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 463 Number of extensions: 21 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 392 Length of database: 400 Length adjustment: 31 Effective length of query: 361 Effective length of database: 369 Effective search space: 133209 Effective search space used: 133209 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory