GapMind for catabolism of small carbon sources

 

Protein WP_084058302.1 in Desulfacinum hydrothermale DSM 13146

Annotation: NCBI__GCF_900176285.1:WP_084058302.1

Length: 361 amino acids

Source: GCF_900176285.1 in NCBI

Candidate for 53 steps in catabolism of small carbon sources

Pathway Step Score Similar to Id. Cov. Bits Other hit Other id. Other bits
glycerol catabolism glpT hi GlpT, component of Glycerol uptake porter, GlpSTPQV (characterized) 55% 98% 400.2 sn-glycerol-3-phosphate import ATP-binding protein UgpC; EC 7.6.2.10 37% 223.8
D-maltose catabolism thuK med ThuK aka RB0314 aka SMB20328, component of Trehalose/maltose/sucrose porter (trehalose inducible) (characterized) 40% 71% 186.4 GlpT, component of Glycerol uptake porter, GlpSTPQV 55% 400.2
sucrose catabolism thuK med ThuK aka RB0314 aka SMB20328, component of Trehalose/maltose/sucrose porter (trehalose inducible) (characterized) 40% 71% 186.4 GlpT, component of Glycerol uptake porter, GlpSTPQV 55% 400.2
trehalose catabolism thuK med ThuK aka RB0314 aka SMB20328, component of Trehalose/maltose/sucrose porter (trehalose inducible) (characterized) 40% 71% 186.4 GlpT, component of Glycerol uptake porter, GlpSTPQV 55% 400.2
D-mannitol catabolism mtlK lo SmoK aka POLK, component of Hexitol (glucitol; mannitol) porter (characterized) 39% 95% 223 GlpT, component of Glycerol uptake porter, GlpSTPQV 55% 400.2
D-maltose catabolism malK_Aa lo ABC-type maltose transporter (EC 7.5.2.1) (characterized) 37% 88% 215.7 GlpT, component of Glycerol uptake porter, GlpSTPQV 55% 400.2
D-maltose catabolism malK lo Maltose-transporting ATPase (EC 3.6.3.19) (characterized) 38% 86% 215.3 GlpT, component of Glycerol uptake porter, GlpSTPQV 55% 400.2
D-cellobiose catabolism gtsD lo ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized) 36% 93% 213.4 GlpT, component of Glycerol uptake porter, GlpSTPQV 55% 400.2
D-glucose catabolism gtsD lo ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized) 36% 93% 213.4 GlpT, component of Glycerol uptake porter, GlpSTPQV 55% 400.2
lactose catabolism gtsD lo ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized) 36% 93% 213.4 GlpT, component of Glycerol uptake porter, GlpSTPQV 55% 400.2
D-maltose catabolism gtsD lo ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized) 36% 93% 213.4 GlpT, component of Glycerol uptake porter, GlpSTPQV 55% 400.2
sucrose catabolism gtsD lo ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized) 36% 93% 213.4 GlpT, component of Glycerol uptake porter, GlpSTPQV 55% 400.2
trehalose catabolism gtsD lo ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized) 36% 93% 213.4 GlpT, component of Glycerol uptake porter, GlpSTPQV 55% 400.2
D-xylose catabolism gtsD lo ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized) 36% 93% 213.4 GlpT, component of Glycerol uptake porter, GlpSTPQV 55% 400.2
D-maltose catabolism malK1 lo MalK; aka Sugar ABC transporter, ATP-binding protein, component of The maltose, maltotriose, mannotetraose (MalE1)/maltose, maltotriose, trehalose (MalE2) porter (Nanavati et al., 2005). For MalG1 (823aas) and MalG2 (833aas), the C-terminal transmembrane domain with 6 putative TMSs is preceded by a single N-terminal TMS and a large (600 residue) hydrophilic region showing sequence similarity to MLP1 and 2 (9.A.14; e-12 & e-7) as well as other proteins (characterized) 38% 94% 213 GlpT, component of Glycerol uptake porter, GlpSTPQV 55% 400.2
D-maltose catabolism malK_Sm lo MalK, component of Maltose/Maltotriose/maltodextrin (up to 7 glucose units) transporters MalXFGK (MsmK (3.A.1.1.28) can probably substitute for MalK; Webb et al., 2008) (characterized) 36% 95% 213 GlpT, component of Glycerol uptake porter, GlpSTPQV 55% 400.2
trehalose catabolism malK lo MalK, component of Maltose/Maltotriose/maltodextrin (up to 7 glucose units) transporters MalXFGK (MsmK (3.A.1.1.28) can probably substitute for MalK; Webb et al., 2008) (characterized) 36% 95% 213 GlpT, component of Glycerol uptake porter, GlpSTPQV 55% 400.2
D-galactose catabolism PfGW456L13_1897 lo ABC transporter for D-Galactose and D-Glucose, ATPase component (characterized) 36% 92% 212.2 GlpT, component of Glycerol uptake porter, GlpSTPQV 55% 400.2
xylitol catabolism HSERO_RS17020 lo ABC-type sugar transport system, ATPase component protein (characterized, see rationale) 38% 84% 208 GlpT, component of Glycerol uptake porter, GlpSTPQV 55% 400.2
D-cellobiose catabolism SMc04256 lo ABC transporter for D-Cellobiose and D-Salicin, ATPase component (characterized) 38% 87% 203 GlpT, component of Glycerol uptake porter, GlpSTPQV 55% 400.2
L-fucose catabolism SM_b21106 lo ABC transporter for L-Fucose, ATPase component (characterized) 36% 100% 202.6 GlpT, component of Glycerol uptake porter, GlpSTPQV 55% 400.2
D-maltose catabolism musK lo ABC-type maltose transporter (EC 7.5.2.1) (characterized) 36% 90% 202.6 GlpT, component of Glycerol uptake porter, GlpSTPQV 55% 400.2
D-sorbitol (glucitol) catabolism mtlK lo ABC transporter for D-Sorbitol, ATPase component (characterized) 39% 81% 202.6 GlpT, component of Glycerol uptake porter, GlpSTPQV 55% 400.2
D-cellobiose catabolism msiK lo MsiK protein, component of The cellobiose/cellotriose (and possibly higher cellooligosaccharides), CebEFGMsiK [MsiK functions to energize several ABC transporters including those for maltose/maltotriose and trehalose] (characterized) 36% 78% 200.7 GlpT, component of Glycerol uptake porter, GlpSTPQV 55% 400.2
D-mannose catabolism TT_C0211 lo Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 36% 92% 199.9 GlpT, component of Glycerol uptake porter, GlpSTPQV 55% 400.2
N-acetyl-D-glucosamine catabolism SMc02869 lo N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized) 38% 80% 195.7 GlpT, component of Glycerol uptake porter, GlpSTPQV 55% 400.2
D-glucosamine (chitosamine) catabolism SMc02869 lo N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized) 38% 80% 195.7 GlpT, component of Glycerol uptake porter, GlpSTPQV 55% 400.2
D-glucosamine (chitosamine) catabolism SM_b21216 lo ABC transporter for D-Glucosamine, ATPase component (characterized) 37% 84% 193.4 GlpT, component of Glycerol uptake porter, GlpSTPQV 55% 400.2
lactose catabolism lacK lo LacK, component of Lactose porter (characterized) 36% 86% 193 GlpT, component of Glycerol uptake porter, GlpSTPQV 55% 400.2
D-maltose catabolism aglK lo ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) 39% 83% 192.6 GlpT, component of Glycerol uptake porter, GlpSTPQV 55% 400.2
sucrose catabolism aglK lo ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) 39% 83% 192.6 GlpT, component of Glycerol uptake porter, GlpSTPQV 55% 400.2
trehalose catabolism aglK lo ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) 39% 83% 192.6 GlpT, component of Glycerol uptake porter, GlpSTPQV 55% 400.2
D-maltose catabolism malK_Bb lo ABC-type maltose transport, ATP binding protein (characterized, see rationale) 34% 91% 191.8 GlpT, component of Glycerol uptake porter, GlpSTPQV 55% 400.2
xylitol catabolism Dshi_0546 lo ABC transporter for Xylitol, ATPase component (characterized) 36% 93% 191 GlpT, component of Glycerol uptake porter, GlpSTPQV 55% 400.2
L-arabinose catabolism xacK lo Xylose/arabinose import ATP-binding protein XacK; EC 7.5.2.13 (characterized, see rationale) 35% 93% 189.9 GlpT, component of Glycerol uptake porter, GlpSTPQV 55% 400.2
putrescine catabolism potA lo Spermidine/putrescine import ATP-binding protein PotA, component of The spermidine/putrescine uptake porter, PotABCD (characterized) 33% 92% 188.3 GlpT, component of Glycerol uptake porter, GlpSTPQV 55% 400.2
trehalose catabolism treV lo TreV, component of Trehalose porter (characterized) 41% 69% 186 GlpT, component of Glycerol uptake porter, GlpSTPQV 55% 400.2
D-cellobiose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 37% 75% 178.7 GlpT, component of Glycerol uptake porter, GlpSTPQV 55% 400.2
D-glucose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 37% 75% 178.7 GlpT, component of Glycerol uptake porter, GlpSTPQV 55% 400.2
lactose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 37% 75% 178.7 GlpT, component of Glycerol uptake porter, GlpSTPQV 55% 400.2
D-maltose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 37% 75% 178.7 GlpT, component of Glycerol uptake porter, GlpSTPQV 55% 400.2
sucrose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 37% 75% 178.7 GlpT, component of Glycerol uptake porter, GlpSTPQV 55% 400.2
trehalose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 37% 75% 178.7 GlpT, component of Glycerol uptake porter, GlpSTPQV 55% 400.2
L-arabinose catabolism xacJ lo Xylose/arabinose import ATP-binding protein XacJ; EC 7.5.2.13 (characterized, see rationale) 36% 78% 177.6 GlpT, component of Glycerol uptake porter, GlpSTPQV 55% 400.2
D-cellobiose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 32% 99% 169.9 GlpT, component of Glycerol uptake porter, GlpSTPQV 55% 400.2
D-galactose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 32% 99% 169.9 GlpT, component of Glycerol uptake porter, GlpSTPQV 55% 400.2
D-glucose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 32% 99% 169.9 GlpT, component of Glycerol uptake porter, GlpSTPQV 55% 400.2
lactose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 32% 99% 169.9 GlpT, component of Glycerol uptake porter, GlpSTPQV 55% 400.2
D-maltose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 32% 99% 169.9 GlpT, component of Glycerol uptake porter, GlpSTPQV 55% 400.2
D-mannose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 32% 99% 169.9 GlpT, component of Glycerol uptake porter, GlpSTPQV 55% 400.2
sucrose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 32% 99% 169.9 GlpT, component of Glycerol uptake porter, GlpSTPQV 55% 400.2
trehalose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 32% 99% 169.9 GlpT, component of Glycerol uptake porter, GlpSTPQV 55% 400.2
glycerol catabolism glpS lo GlpS, component of Glycerol uptake porter, GlpSTPQV (characterized) 32% 77% 146 GlpT, component of Glycerol uptake porter, GlpSTPQV 55% 400.2

Sequence Analysis Tools

View WP_084058302.1 at NCBI

Find papers: PaperBLAST

Find functional residues: SitesBLAST

Search for conserved domains

Find the best match in UniProt

Compare to protein structures

Predict transmenbrane helices: Phobius

Predict protein localization: PSORTb

Find homologs in fast.genomics

Fitness BLAST: loading...

Sequence

MARITLQQVAHSYQRHPKDPSDYALKNIDTVWEDGGAYALLGPSGCGKTTMLNIISGLLT
PTRGRVLYDDRDVTELPPEQRNIAQVFQFPVLYDTMSVFDNLAFPLRNRGLDPQTIHRRV
QEVAEVLDLTADLKKKAAGLSADAKQKISLGRGLVREDVAAILFDEPLTVIDPHLKWHLR
RKLKEIHEKLQLTLIYVTHDQVEALTFADKVLVMYEGEMVQMGTPAELFEEPRHKFVGYF
IGSPGMNFIPCRLEGNRAVCDGASVVLDEETVRRAQGKEGPFELGIRPMYLEVHDEPGDD
RIPVQVRKVEDQGIFRILTVQMASSTLKVRISEERPLPGQEAWIRFPRRWIKLYANGRLV
A

This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory