Align arginase (EC 3.5.3.1) (characterized)
to candidate WP_084075870.1 BUB04_RS18635 agmatinase
Query= metacyc::MONOMER-14987 (338 letters) >NCBI__GCF_900129305.1:WP_084075870.1 Length = 469 Score = 229 bits (583), Expect = 1e-64 Identities = 134/289 (46%), Positives = 181/289 (62%), Gaps = 17/289 (5%) Query: 48 GELVRALGGAVASTSLLGVPLGHNSSFLQGPAFAPPRIREAMWCGSTNSTTEEGKELDDP 107 G LV L A ++LGVP NSS +GPA AP RIREA+ GS N T E G LD Sbjct: 191 GALVERLRRLAARVTVLGVPFDANSSHRRGPALAPGRIREALRSGSMNLTAECGLALDRN 250 Query: 108 RILTDVGDVPVQELRDAGVDDDRLMSIISESVKLVMEENPLRPLVLGGDHSISYPVVRAV 167 D GD+ + ++ + +V +++ L LGGDHSI+ PVVRAV Sbjct: 251 DQWADAGDLSFS-------GTESMVEKVQRAVDGILKLGGA-VLALGGDHSITVPVVRAV 302 Query: 168 SEKLGGPIDILHLDAHPDIYHAFEGNKYSHASSFARIMEGGYARRLLQVGIRSINKEGRE 227 + + GP++ILHLDAHPD+Y A +GN SH S FARI+E G ARRL+QVG+R++N+E R+ Sbjct: 303 AAR-HGPLNILHLDAHPDLYPALDGNPMSHGSPFARILEEGLARRLVQVGVRTMNEEQRK 361 Query: 228 QGKRFGVEQYEMRTFSQDRQFLENLKLGEGVKGVYISVDVDCMDPAFAPGVSHIEPGGLS 287 +RFGVE M ++ E VY+S+DVDC+DPA+APGVSH EPGGLS Sbjct: 362 VAERFGVEVLSMDRWNGTGDL-------EFDGPVYLSLDVDCLDPAYAPGVSHPEPGGLS 414 Query: 288 FRDVLNILHNLQADVVGADVVEFNPQRDTVDGMTAMVAAKLVRELTAKI 336 R VL +++ L+ +VGAD+VE NP+RD G+TA + AKL +E+ A++ Sbjct: 415 TRQVLRLVNGLRGRLVGADLVEINPERDP-SGITAALGAKLFKEILARM 462 Lambda K H 0.318 0.136 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 424 Number of extensions: 18 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 338 Length of database: 469 Length adjustment: 31 Effective length of query: 307 Effective length of database: 438 Effective search space: 134466 Effective search space used: 134466 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory