Align serine racemase (EC 5.1.1.18) (characterized)
to candidate WP_084076500.1 BUB04_RS13615 pyridoxal-5'-phosphate-dependent protein
Query= BRENDA::O59791 (323 letters) >NCBI__GCF_900129305.1:WP_084076500.1 Length = 296 Score = 261 bits (668), Expect = 1e-74 Identities = 138/290 (47%), Positives = 189/290 (65%), Gaps = 2/290 (0%) Query: 34 TVNKEFVAEVFFKCENFQKMGAFKFRGALNALSQLNEAQRKAGVLTFSSGNHAQAIALSA 93 T++K A FKCEN Q++GAFKFRGA NALS+L+ +R+ GV+T SSGNHAQA+AL Sbjct: 5 TLDKMLGARFHFKCENLQRIGAFKFRGAFNALSRLSPEERRRGVVTISSGNHAQAVALVG 64 Query: 94 KILGIPAKIIMPLDAPEAKVAATKGYGGQVIMYDRYKDDREKMAKEISEREGLTIIPPYD 153 + LGI ++MP +APE K A +GYG ++ YD RE+ + + E + IPP+D Sbjct: 65 RELGIDTTVLMPANAPEIKRRAVEGYGATIVTYDPATTRREEALRAVDGGERV-FIPPFD 123 Query: 154 HPHVLAGQGTAAKELFEEVGPLDALFVCLGGGGLLSGSALAARHFAPNCEVYGVEPEAGN 213 H V+AGQGTA EL + V LD L V GGGGLLSG A+A + + P C V GVEPE+ + Sbjct: 124 HWDVIAGQGTAGLELAQAVSHLDMLLVPCGGGGLLSGCAVAVKGYFPRCRVVGVEPESAD 183 Query: 214 DGQQSFRKGSIVHIDTPKTIADGAQTQHLGNYTFSIIKEKVDDILTVSDEELIDCLKFYA 273 D +SFR G++ + P TIADG +T LG+ TF ++ VDD+ TVS+E + + ++F Sbjct: 184 DATRSFRMGTLQEVHNPPTIADGVRTPRLGDITFPLVLAHVDDMRTVSEEAIREAVRFLF 243 Query: 274 ARMKIVVEPTGCLSFAAARAMKEKLKNKRIGIIISGGNVDIERYAHFLSQ 323 RMK+VVEP+G L AA + K +GI++SGGNVD + A LS+ Sbjct: 244 YRMKLVVEPSGALGLAALLSGAVK-PTGDVGILLSGGNVDGQTMAGILSE 292 Lambda K H 0.318 0.135 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 249 Number of extensions: 6 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 323 Length of database: 296 Length adjustment: 27 Effective length of query: 296 Effective length of database: 269 Effective search space: 79624 Effective search space used: 79624 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory