Align L-arabinolactonase (EC 3.1.1.15) / D-galactonolactonase (EC 3.1.1.25) (characterized)
to candidate WP_084150767.1 H537_RS0117510 SMP-30/gluconolactonase/LRE family protein
Query= reanno::pseudo5_N2C3_1:AO356_20235 (291 letters) >NCBI__GCF_000430725.1:WP_084150767.1 Length = 291 Score = 143 bits (361), Expect = 4e-39 Identities = 104/292 (35%), Positives = 139/292 (47%), Gaps = 20/292 (6%) Query: 10 RAKLGEGPFWDAPTQALYWVDIAGKQALRLIGANVEI--WQMPEHVSAFIPTQSGDALVT 67 R ++GE P W QALYWVDI ++ RL A E W MPE ++ G L Sbjct: 8 RNRVGECPLWSVAEQALYWVDIDSRRLHRLDWATRETVQWDMPERLACIALHAQGGLLAG 67 Query: 68 LSSGVYRLDLDSPGLEPRLTLLCMADPQPGNRANEARCDPQGQLWLGTMQNNIGAEGEDL 127 + +G++RL G L P G R N+ RCD G+ W+ +M D+ Sbjct: 68 METGLFRLQPQRGGTIDVERLQAATFPHRGMRFNDGRCDRHGRFWVTSMVM-------DM 120 Query: 128 PIEHRSGGLFRVGSDGRVLPLLRGLGIPNTLLWSPDGTTVYFGDSLDGT--VYRHFIYPE 185 + G L+R + G V P+L GL N L +SPDG T+Y DS ++ + Sbjct: 121 SLGLAKGMLWRHDARGLV-PMLGGLLTGNGLGFSPDGRTLYLSDSHPKAQRIWAFDLDIS 179 Query: 186 GNLAPAE--VWFGPHPRGGPDGSAMDARGYIWNARWDGSCLLRLTPDGQVDRVIELPVSR 243 GNL V HP G PDG+A+DA G W D + R PDG + + + +PVS+ Sbjct: 180 GNLGNRREFVDMNHHP-GRPDGAAVDAAGAYWICGNDAGQVHRFRPDGTLRQSLPVPVSK 238 Query: 244 PTSCVFGGEDLKTLYITS-----AASPLGHPLDGAVLSMRVDVPGVACTRFA 290 P C FGG DL L++TS A LDGAV R V G+A T FA Sbjct: 239 PAMCSFGGPDLDHLFVTSILPAQPAQDFDAALDGAVFVARPGVRGIAETPFA 290 Lambda K H 0.319 0.140 0.455 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 372 Number of extensions: 24 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 291 Length of database: 291 Length adjustment: 26 Effective length of query: 265 Effective length of database: 265 Effective search space: 70225 Effective search space used: 70225 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory