Protein WP_084274804.1 in Nitratiruptor tergarcus DSM 16512
Annotation: NCBI__GCF_900176045.1:WP_084274804.1
Length: 220 amino acids
Source: GCF_900176045.1 in NCBI
Candidate for 41 steps in catabolism of small carbon sources
| Pathway | Step | Score | Similar to | Id. | Cov. | Bits | Other hit | Other id. | Other bits |
|---|
| L-arginine catabolism | artP | med | BgtA aka SLR1735, component of Arginine/lysine/histidine/glutamine porter (characterized) | 41% | 81% | 133.3 | Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- | 52% | 226.1 |
| L-histidine catabolism | bgtA | med | BgtA aka SLR1735, component of Arginine/lysine/histidine/glutamine porter (characterized) | 41% | 81% | 133.3 | Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- | 52% | 226.1 |
| L-lysine catabolism | hisP | med | BgtA aka SLR1735, component of Arginine/lysine/histidine/glutamine porter (characterized) | 41% | 81% | 133.3 | Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- | 52% | 226.1 |
| L-asparagine catabolism | bztD | lo | BztD, component of Glutamate/glutamine/aspartate/asparagine porter (characterized) | 39% | 77% | 147.5 | Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- | 52% | 226.1 |
| L-aspartate catabolism | bztD | lo | BztD, component of Glutamate/glutamine/aspartate/asparagine porter (characterized) | 39% | 77% | 147.5 | Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- | 52% | 226.1 |
| L-glutamate catabolism | gltL | lo | BztD, component of Glutamate/glutamine/aspartate/asparagine porter (characterized) | 39% | 77% | 147.5 | Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- | 52% | 226.1 |
| L-asparagine catabolism | bgtA | lo | ATPase (characterized, see rationale) | 39% | 77% | 144.1 | Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- | 52% | 226.1 |
| L-aspartate catabolism | bgtA | lo | ATPase (characterized, see rationale) | 39% | 77% | 144.1 | Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- | 52% | 226.1 |
| L-asparagine catabolism | aatP | lo | ABC transporter for L-asparagine and L-glutamate, ATPase component (characterized) | 38% | 89% | 142.9 | Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- | 52% | 226.1 |
| L-aspartate catabolism | aatP | lo | ABC transporter for L-asparagine and L-glutamate, ATPase component (characterized) | 38% | 89% | 142.9 | Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- | 52% | 226.1 |
| L-histidine catabolism | hisP | lo | Probable ATP-binding component of ABC transporter, component of Amino acid transporter, PA5152-PA5155. Probably transports numerous amino acids including lysine, arginine, histidine, D-alanine and D-valine (Johnson et al. 2008). Regulated by ArgR (characterized) | 38% | 87% | 142.9 | Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- | 52% | 226.1 |
| L-histidine catabolism | aapP | lo | ABC transporter for L-Glutamine, L-Histidine, and other L-amino acids, ATPase component (characterized) | 36% | 84% | 138.7 | Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- | 52% | 226.1 |
| L-asparagine catabolism | aapP | lo | AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) | 35% | 85% | 137.9 | Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- | 52% | 226.1 |
| L-aspartate catabolism | aapP | lo | AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) | 35% | 85% | 137.9 | Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- | 52% | 226.1 |
| L-glutamate catabolism | aapP | lo | AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) | 35% | 85% | 137.9 | Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- | 52% | 226.1 |
| L-leucine catabolism | aapP | lo | AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) | 35% | 85% | 137.9 | Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- | 52% | 226.1 |
| L-proline catabolism | aapP | lo | AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) | 35% | 85% | 137.9 | Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- | 52% | 226.1 |
| L-histidine catabolism | PA5503 | lo | Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN (characterized) | 35% | 66% | 137.1 | Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- | 52% | 226.1 |
| D-alanine catabolism | Pf6N2E2_5405 | lo | ABC transporter for D-Alanine, ATPase component (characterized) | 37% | 80% | 133.3 | Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- | 52% | 226.1 |
| D-glucosamine (chitosamine) catabolism | AO353_21725 | lo | ABC transporter for D-glucosamine, ATPase component (characterized) | 36% | 85% | 132.9 | Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- | 52% | 226.1 |
| L-citrulline catabolism | PS417_17605 | lo | ATP-binding cassette domain-containing protein; SubName: Full=Amino acid transporter; SubName: Full=Histidine ABC transporter ATP-binding protein; SubName: Full=Histidine transport system ATP-binding protein (characterized, see rationale) | 35% | 76% | 131 | Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- | 52% | 226.1 |
| L-histidine catabolism | BPHYT_RS24015 | lo | ABC transporter related (characterized, see rationale) | 34% | 86% | 128.6 | Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- | 52% | 226.1 |
| D-cellobiose catabolism | gtsD | lo | Sugar ABC transporter ATP-binding protein (characterized, see rationale) | 34% | 61% | 120.9 | Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- | 52% | 226.1 |
| D-glucose catabolism | gtsD | lo | Sugar ABC transporter ATP-binding protein (characterized, see rationale) | 34% | 61% | 120.9 | Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- | 52% | 226.1 |
| lactose catabolism | gtsD | lo | Sugar ABC transporter ATP-binding protein (characterized, see rationale) | 34% | 61% | 120.9 | Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- | 52% | 226.1 |
| D-maltose catabolism | gtsD | lo | Sugar ABC transporter ATP-binding protein (characterized, see rationale) | 34% | 61% | 120.9 | Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- | 52% | 226.1 |
| sucrose catabolism | gtsD | lo | Sugar ABC transporter ATP-binding protein (characterized, see rationale) | 34% | 61% | 120.9 | Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- | 52% | 226.1 |
| trehalose catabolism | gtsD | lo | Sugar ABC transporter ATP-binding protein (characterized, see rationale) | 34% | 61% | 120.9 | Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- | 52% | 226.1 |
| D-cellobiose catabolism | aglK' | lo | Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) | 34% | 57% | 113.2 | Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- | 52% | 226.1 |
| D-glucose catabolism | aglK' | lo | Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) | 34% | 57% | 113.2 | Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- | 52% | 226.1 |
| lactose catabolism | aglK' | lo | Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) | 34% | 57% | 113.2 | Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- | 52% | 226.1 |
| D-maltose catabolism | aglK | lo | Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) | 34% | 57% | 113.2 | Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- | 52% | 226.1 |
| D-maltose catabolism | aglK' | lo | Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) | 34% | 57% | 113.2 | Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- | 52% | 226.1 |
| sucrose catabolism | aglK | lo | Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) | 34% | 57% | 113.2 | Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- | 52% | 226.1 |
| sucrose catabolism | aglK' | lo | Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) | 34% | 57% | 113.2 | Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- | 52% | 226.1 |
| trehalose catabolism | aglK | lo | Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) | 34% | 57% | 113.2 | Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- | 52% | 226.1 |
| trehalose catabolism | aglK' | lo | Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) | 34% | 57% | 113.2 | Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- | 52% | 226.1 |
| D-galactose catabolism | PfGW456L13_1897 | lo | ABC transporter for D-Galactose and D-Glucose, ATPase component (characterized) | 34% | 55% | 112.8 | Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- | 52% | 226.1 |
| D-mannose catabolism | TM1749 | lo | TM1749, component of Probable mannose/mannoside porter. Induced by beta-mannan (Conners et al., 2005). Regulated by mannose-responsive regulator manR (characterized) | 32% | 72% | 111.3 | Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- | 52% | 226.1 |
| D-xylose catabolism | gtsD | lo | ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized) | 34% | 55% | 110.5 | Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- | 52% | 226.1 |
| trehalose catabolism | thuK | lo | Trehalose import ATP-binding protein SugC; EC 7.5.2.- (characterized) | 33% | 54% | 107.8 | Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- | 52% | 226.1 |
Sequence Analysis Tools
View WP_084274804.1 at NCBI
Find papers: PaperBLAST
Find functional residues: SitesBLAST
Search for conserved domains
Find the best match in UniProt
Compare to protein structures
Predict transmenbrane helices: Phobius
Predict protein localization: PSORTb
Find homologs in fast.genomics
Fitness BLAST: loading...
Sequence
MLIECKNITKTFQIGDLTTTVLHDINITINEGDFLAIMGSSGSGKSTLLYILGCLDKASG
GTYLIDGKNVAKLSDDELSHLRNTMFGFIFQAFYLIPYLNVLDNVLIPTLYTTHPPTQSK
AKTLLEKLQLTQRMEYYPDQLSGGQKQRVAIARALINDPKVILADEPTGQLDSQNAKNVM
EILQQLNSEGKTIVLVTHDPAMAQYAKKVVRIQDGRIVSS
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Links
Downloads
Related tools
About GapMind
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using
ublast (a fast alternative to protein BLAST)
against a database of manually-curated proteins (most of which are experimentally characterized) or by using
HMMer with enzyme models (usually from
TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
- ublast finds a hit to a characterized protein at above 40% identity and 80% coverage, and bits >= other bits+10.
- (Hits to curated proteins without experimental data as to their function are never considered high confidence.)
- HMMer finds a hit with 80% coverage of the model, and either other identity < 40 or other coverage < 0.75.
where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").
Otherwise, a candidate is "medium confidence" if either:
- ublast finds a hit at above 40% identity and 70% coverage (ignoring otherBits).
- ublast finds a hit at above 30% identity and 80% coverage, and bits >= other bits.
- HMMer finds a hit (regardless of coverage or other bits).
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps."
For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways.
For diverse bacteria and archaea that can utilize a carbon source, there is a complete
high-confidence catabolic pathway (including a transporter) just 38% of the time, and
there is a complete medium-confidence pathway 63% of the time.
Gaps may be due to:
- our ignorance of proteins' functions,
- omissions in the gene models,
- frame-shift errors in the genome sequence, or
- the organism lacks the pathway.
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory