GapMind for catabolism of small carbon sources

 

Protein WP_084275369.1 in Nitratiruptor tergarcus DSM 16512

Annotation: NCBI__GCF_900176045.1:WP_084275369.1

Length: 243 amino acids

Source: GCF_900176045.1 in NCBI

Candidate for 42 steps in catabolism of small carbon sources

Pathway Step Score Similar to Id. Cov. Bits Other hit Other id. Other bits
L-proline catabolism opuBA lo BusAA, component of Uptake system for glycine-betaine (high affinity) and proline (low affinity) (OpuAA-OpuABC) or BusAA-ABC of Lactococcus lactis). BusAA, the ATPase subunit, has a C-terminal tandem cystathionine β-synthase (CBS) domain which is the cytoplasmic K+ sensor for osmotic stress (osmotic strength)while the BusABC subunit has the membrane and receptor domains fused to each other (Biemans-Oldehinkel et al., 2006; Mahmood et al., 2006; Gul et al. 2012). An N-terminal amphipathic α-helix of OpuA is necessary for high activity but is not critical for biogenesis or the ionic regulation of transport (characterized) 37% 66% 153.7 Aliphatic sulfonates import ATP-binding protein SsuB; EC 7.6.2.- 42% 177.9
putrescine catabolism potA lo Spermidine/putrescine import ATP-binding protein PotA, component of The spermidine/putrescine uptake porter, PotABCD (characterized) 41% 53% 142.1 Aliphatic sulfonates import ATP-binding protein SsuB; EC 7.6.2.- 42% 177.9
sucrose catabolism thuK lo ABC transporter (characterized, see rationale) 40% 56% 139.4 Aliphatic sulfonates import ATP-binding protein SsuB; EC 7.6.2.- 42% 177.9
L-histidine catabolism Ac3H11_2560 lo ABC transporter for L-Histidine, ATPase component (characterized) 35% 82% 139 Aliphatic sulfonates import ATP-binding protein SsuB; EC 7.6.2.- 42% 177.9
L-proline catabolism proV lo glycine betaine/l-proline transport atp-binding protein prov (characterized) 36% 58% 138.7 Aliphatic sulfonates import ATP-binding protein SsuB; EC 7.6.2.- 42% 177.9
D-cellobiose catabolism gtsD lo Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 35% 65% 134.4 Aliphatic sulfonates import ATP-binding protein SsuB; EC 7.6.2.- 42% 177.9
D-glucose catabolism gtsD lo Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 35% 65% 134.4 Aliphatic sulfonates import ATP-binding protein SsuB; EC 7.6.2.- 42% 177.9
lactose catabolism gtsD lo Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 35% 65% 134.4 Aliphatic sulfonates import ATP-binding protein SsuB; EC 7.6.2.- 42% 177.9
D-maltose catabolism gtsD lo Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 35% 65% 134.4 Aliphatic sulfonates import ATP-binding protein SsuB; EC 7.6.2.- 42% 177.9
D-maltose catabolism thuK lo Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 35% 65% 134.4 Aliphatic sulfonates import ATP-binding protein SsuB; EC 7.6.2.- 42% 177.9
D-mannose catabolism TT_C0211 lo Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 35% 65% 134.4 Aliphatic sulfonates import ATP-binding protein SsuB; EC 7.6.2.- 42% 177.9
sucrose catabolism gtsD lo Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 35% 65% 134.4 Aliphatic sulfonates import ATP-binding protein SsuB; EC 7.6.2.- 42% 177.9
trehalose catabolism gtsD lo Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 35% 65% 134.4 Aliphatic sulfonates import ATP-binding protein SsuB; EC 7.6.2.- 42% 177.9
trehalose catabolism thuK lo Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 35% 65% 134.4 Aliphatic sulfonates import ATP-binding protein SsuB; EC 7.6.2.- 42% 177.9
D-maltose catabolism malK lo ABC-type maltose transporter (subunit 3/3) (EC 7.5.2.1) (characterized) 37% 58% 134 Aliphatic sulfonates import ATP-binding protein SsuB; EC 7.6.2.- 42% 177.9
D-mannitol catabolism mtlK lo ABC transporter for D-mannitol and D-mannose, ATPase component (characterized) 39% 58% 133.3 Aliphatic sulfonates import ATP-binding protein SsuB; EC 7.6.2.- 42% 177.9
D-sorbitol (glucitol) catabolism mtlK lo ABC transporter for D-Mannitol, D-Mannose, and D-Sorbitol, ATPase component (characterized) 39% 58% 132.9 Aliphatic sulfonates import ATP-binding protein SsuB; EC 7.6.2.- 42% 177.9
L-histidine catabolism hutV lo ABC transporter for L-Histidine, ATPase component (characterized) 37% 82% 130.6 Aliphatic sulfonates import ATP-binding protein SsuB; EC 7.6.2.- 42% 177.9
D-maltose catabolism malK_Bb lo ABC-type maltose transport, ATP binding protein (characterized, see rationale) 37% 60% 130.2 Aliphatic sulfonates import ATP-binding protein SsuB; EC 7.6.2.- 42% 177.9
N-acetyl-D-glucosamine catabolism SMc02869 lo N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized) 37% 66% 129.8 Aliphatic sulfonates import ATP-binding protein SsuB; EC 7.6.2.- 42% 177.9
D-glucosamine (chitosamine) catabolism SMc02869 lo N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized) 37% 66% 129.8 Aliphatic sulfonates import ATP-binding protein SsuB; EC 7.6.2.- 42% 177.9
D-maltose catabolism malK_Aa lo ABC-type maltose transporter (EC 7.5.2.1) (characterized) 35% 60% 128.6 Aliphatic sulfonates import ATP-binding protein SsuB; EC 7.6.2.- 42% 177.9
xylitol catabolism Dshi_0546 lo ABC transporter for Xylitol, ATPase component (characterized) 38% 63% 128.3 Aliphatic sulfonates import ATP-binding protein SsuB; EC 7.6.2.- 42% 177.9
lactose catabolism lacK lo LacK, component of Lactose porter (characterized) 35% 62% 126.3 Aliphatic sulfonates import ATP-binding protein SsuB; EC 7.6.2.- 42% 177.9
L-isoleucine catabolism livG lo ABC transporter ATP-binding protein-branched chain amino acid transport, component of The branched chain hydrophobic amino acid transporter, LivJFGHM (characterized) 35% 100% 125.9 Aliphatic sulfonates import ATP-binding protein SsuB; EC 7.6.2.- 42% 177.9
L-leucine catabolism livG lo ABC transporter ATP-binding protein-branched chain amino acid transport, component of The branched chain hydrophobic amino acid transporter, LivJFGHM (characterized) 35% 100% 125.9 Aliphatic sulfonates import ATP-binding protein SsuB; EC 7.6.2.- 42% 177.9
L-valine catabolism livG lo ABC transporter ATP-binding protein-branched chain amino acid transport, component of The branched chain hydrophobic amino acid transporter, LivJFGHM (characterized) 35% 100% 125.9 Aliphatic sulfonates import ATP-binding protein SsuB; EC 7.6.2.- 42% 177.9
L-fucose catabolism SM_b21106 lo ABC transporter for L-Fucose, ATPase component (characterized) 35% 57% 124 Aliphatic sulfonates import ATP-binding protein SsuB; EC 7.6.2.- 42% 177.9
D-cellobiose catabolism SMc04256 lo ABC transporter for D-Cellobiose and D-Salicin, ATPase component (characterized) 36% 58% 123.6 Aliphatic sulfonates import ATP-binding protein SsuB; EC 7.6.2.- 42% 177.9
xylitol catabolism HSERO_RS17020 lo ABC-type sugar transport system, ATPase component protein (characterized, see rationale) 35% 53% 123.6 Aliphatic sulfonates import ATP-binding protein SsuB; EC 7.6.2.- 42% 177.9
L-arabinose catabolism xacK lo Xylose/arabinose import ATP-binding protein XacK; EC 7.5.2.13 (characterized, see rationale) 35% 59% 120.9 Aliphatic sulfonates import ATP-binding protein SsuB; EC 7.6.2.- 42% 177.9
D-cellobiose catabolism msiK lo MsiK protein, component of The cellobiose/cellotriose (and possibly higher cellooligosaccharides), CebEFGMsiK [MsiK functions to energize several ABC transporters including those for maltose/maltotriose and trehalose] (characterized) 37% 51% 119.4 Aliphatic sulfonates import ATP-binding protein SsuB; EC 7.6.2.- 42% 177.9
L-proline catabolism hutV lo HutV aka HISV aka R02702 aka SMC00670, component of Uptake system for hisitidine, proline, proline-betaine and glycine-betaine (characterized) 36% 79% 119.4 Aliphatic sulfonates import ATP-binding protein SsuB; EC 7.6.2.- 42% 177.9
D-maltose catabolism malK_Sm lo MalK, component of Maltose/Maltotriose/maltodextrin (up to 7 glucose units) transporters MalXFGK (MsmK (3.A.1.1.28) can probably substitute for MalK; Webb et al., 2008) (characterized) 35% 58% 119 Aliphatic sulfonates import ATP-binding protein SsuB; EC 7.6.2.- 42% 177.9
trehalose catabolism malK lo MalK, component of Maltose/Maltotriose/maltodextrin (up to 7 glucose units) transporters MalXFGK (MsmK (3.A.1.1.28) can probably substitute for MalK; Webb et al., 2008) (characterized) 35% 58% 119 Aliphatic sulfonates import ATP-binding protein SsuB; EC 7.6.2.- 42% 177.9
D-maltose catabolism musK lo ABC-type maltose transporter (EC 7.5.2.1) (characterized) 36% 56% 115.5 Aliphatic sulfonates import ATP-binding protein SsuB; EC 7.6.2.- 42% 177.9
trehalose catabolism treV lo TreV, component of Trehalose porter (characterized) 34% 61% 114 Aliphatic sulfonates import ATP-binding protein SsuB; EC 7.6.2.- 42% 177.9
L-tryptophan catabolism ecfA1 lo Energy-coupling factor transporter ATP-binding protein EcfA1; Short=ECF transporter A component EcfA; EC 7.-.-.- (characterized, see rationale) 32% 85% 104 Aliphatic sulfonates import ATP-binding protein SsuB; EC 7.6.2.- 42% 177.9
L-isoleucine catabolism livF lo ABC transporter ATP-binding protein-branched chain amino acid transport, component of The branched chain hydrophobic amino acid transporter, LivJFGHM (characterized) 33% 93% 103.6 Aliphatic sulfonates import ATP-binding protein SsuB; EC 7.6.2.- 42% 177.9
L-leucine catabolism livF lo ABC transporter ATP-binding protein-branched chain amino acid transport, component of The branched chain hydrophobic amino acid transporter, LivJFGHM (characterized) 33% 93% 103.6 Aliphatic sulfonates import ATP-binding protein SsuB; EC 7.6.2.- 42% 177.9
L-valine catabolism livF lo ABC transporter ATP-binding protein-branched chain amino acid transport, component of The branched chain hydrophobic amino acid transporter, LivJFGHM (characterized) 33% 93% 103.6 Aliphatic sulfonates import ATP-binding protein SsuB; EC 7.6.2.- 42% 177.9
L-phenylalanine catabolism livG lo High-affinity branched-chain amino acid transport ATP-binding protein LivG aka B3455, component of Leucine; leucine/isoleucine/valine porter (characterized) 31% 87% 90.1 Aliphatic sulfonates import ATP-binding protein SsuB; EC 7.6.2.- 42% 177.9

Sequence Analysis Tools

View WP_084275369.1 at NCBI

Find papers: PaperBLAST

Find functional residues: SitesBLAST

Search for conserved domains

Find the best match in UniProt

Compare to protein structures

Predict transmenbrane helices: Phobius

Predict protein localization: PSORTb

Find homologs in fast.genomics

Fitness BLAST: loading...

Sequence

MARLKVEHLTFSFGYKTILEDISFEIHEGEVVSVVGPSGGGKTTLLRLCAGLLDRQEGTI
ENSFKTQSIAFQDPRLLPWKNVLDNIAFGLKAQGVSKKERIKRAQEIALQFDLEEDDFEK
FPKELSGGMSQRVSFARALVTQPELLFLDEPFSALDIGLKRELQNHLIELITKKEITIFF
ITHDLMEAVRLSDKIFVLEPDPGRIVKTFTLDIPQSKRDDSYVYSETAKLLKDPYIIETF
ELE

This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory