GapMind for catabolism of small carbon sources

 

Protein WP_084276079.1 in Nitratiruptor tergarcus DSM 16512

Annotation: NCBI__GCF_900176045.1:WP_084276079.1

Length: 254 amino acids

Source: GCF_900176045.1 in NCBI

Candidate for 42 steps in catabolism of small carbon sources

Pathway Step Score Similar to Id. Cov. Bits Other hit Other id. Other bits
L-proline catabolism proV lo glycine betaine/l-proline transport atp-binding protein prov (characterized) 41% 59% 166.8 toluene tolerance protein Ttg2A 43% 218.8
L-proline catabolism opuBA lo BusAA, component of Uptake system for glycine-betaine (high affinity) and proline (low affinity) (OpuAA-OpuABC) or BusAA-ABC of Lactococcus lactis). BusAA, the ATPase subunit, has a C-terminal tandem cystathionine β-synthase (CBS) domain which is the cytoplasmic K+ sensor for osmotic stress (osmotic strength)while the BusABC subunit has the membrane and receptor domains fused to each other (Biemans-Oldehinkel et al., 2006; Mahmood et al., 2006; Gul et al. 2012). An N-terminal amphipathic α-helix of OpuA is necessary for high activity but is not critical for biogenesis or the ionic regulation of transport (characterized) 36% 57% 149.1 toluene tolerance protein Ttg2A 43% 218.8
D-mannose catabolism TM1750 lo TM1750, component of Probable mannose/mannoside porter. Induced by beta-mannan (Conners et al., 2005). Regulated by mannose-responsive regulator manR (characterized) 34% 78% 146 toluene tolerance protein Ttg2A 43% 218.8
L-lysine catabolism hisP lo ABC transporter for L-Lysine, ATPase component (characterized) 34% 99% 145.6 toluene tolerance protein Ttg2A 43% 218.8
L-histidine catabolism hutV lo ABC transporter for L-Histidine, ATPase component (characterized) 38% 82% 145.2 toluene tolerance protein Ttg2A 43% 218.8
L-citrulline catabolism PS417_17605 lo ATP-binding cassette domain-containing protein; SubName: Full=Amino acid transporter; SubName: Full=Histidine ABC transporter ATP-binding protein; SubName: Full=Histidine transport system ATP-binding protein (characterized, see rationale) 32% 91% 144.4 toluene tolerance protein Ttg2A 43% 218.8
L-histidine catabolism PA5503 lo Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN (characterized) 36% 67% 143.7 toluene tolerance protein Ttg2A 43% 218.8
L-proline catabolism hutV lo HutV aka HISV aka R02702 aka SMC00670, component of Uptake system for hisitidine, proline, proline-betaine and glycine-betaine (characterized) 39% 83% 143.3 toluene tolerance protein Ttg2A 43% 218.8
D-cellobiose catabolism cbtD lo CbtD, component of Cellobiose and cellooligosaccharide porter (characterized) 32% 73% 139.4 toluene tolerance protein Ttg2A 43% 218.8
L-arginine catabolism artP lo ABC transporter for L-Arginine, putative ATPase component (characterized) 34% 96% 138.7 toluene tolerance protein Ttg2A 43% 218.8
D-cellobiose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 36% 65% 138.3 toluene tolerance protein Ttg2A 43% 218.8
D-galactose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 36% 65% 138.3 toluene tolerance protein Ttg2A 43% 218.8
D-glucose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 36% 65% 138.3 toluene tolerance protein Ttg2A 43% 218.8
lactose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 36% 65% 138.3 toluene tolerance protein Ttg2A 43% 218.8
D-maltose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 36% 65% 138.3 toluene tolerance protein Ttg2A 43% 218.8
D-mannose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 36% 65% 138.3 toluene tolerance protein Ttg2A 43% 218.8
putrescine catabolism potA lo Spermidine/putrescine import ATP-binding protein PotA, component of The spermidine/putrescine uptake porter, PotABCD (characterized) 35% 61% 138.3 toluene tolerance protein Ttg2A 43% 218.8
sucrose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 36% 65% 138.3 toluene tolerance protein Ttg2A 43% 218.8
trehalose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 36% 65% 138.3 toluene tolerance protein Ttg2A 43% 218.8
L-histidine catabolism hisP lo Histidine transport ATP-binding protein HisP (characterized) 34% 98% 137.9 toluene tolerance protein Ttg2A 43% 218.8
L-asparagine catabolism glnQ lo Glutamine ABC transporter ATP-binding protein, component of Glutamine transporter, GlnQP. Takes up glutamine, asparagine and glutamate which compete for each other for binding both substrate and the transmembrane protein constituent of the system (Fulyani et al. 2015). Tandem substrate binding domains (SBDs) differ in substrate specificity and affinity, allowing cells to efficiently accumulate different amino acids via a single ABC transporter. Analysis revealed the roles of individual residues in determining the substrate affinity (characterized) 33% 96% 136.7 toluene tolerance protein Ttg2A 43% 218.8
L-glutamate catabolism gltL lo Glutamine ABC transporter ATP-binding protein, component of Glutamine transporter, GlnQP. Takes up glutamine, asparagine and glutamate which compete for each other for binding both substrate and the transmembrane protein constituent of the system (Fulyani et al. 2015). Tandem substrate binding domains (SBDs) differ in substrate specificity and affinity, allowing cells to efficiently accumulate different amino acids via a single ABC transporter. Analysis revealed the roles of individual residues in determining the substrate affinity (characterized) 33% 96% 136.7 toluene tolerance protein Ttg2A 43% 218.8
D-glucosamine (chitosamine) catabolism AO353_21725 lo ABC transporter for D-Glucosamine, putative ATPase component (characterized) 31% 94% 134 toluene tolerance protein Ttg2A 43% 218.8
D-maltose catabolism malK_Bb lo ABC-type maltose transport, ATP binding protein (characterized, see rationale) 34% 68% 133.7 toluene tolerance protein Ttg2A 43% 218.8
N-acetyl-D-glucosamine catabolism SMc02869 lo N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized) 33% 66% 129.8 toluene tolerance protein Ttg2A 43% 218.8
L-arabinose catabolism xacJ lo Xylose/arabinose import ATP-binding protein XacJ; EC 7.5.2.13 (characterized, see rationale) 34% 63% 129.8 toluene tolerance protein Ttg2A 43% 218.8
D-glucosamine (chitosamine) catabolism SMc02869 lo N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized) 33% 66% 129.8 toluene tolerance protein Ttg2A 43% 218.8
L-asparagine catabolism peb1C lo PEB1C, component of Uptake system for glutamate and aspartate (characterized) 33% 98% 129.4 toluene tolerance protein Ttg2A 43% 218.8
L-aspartate catabolism peb1C lo PEB1C, component of Uptake system for glutamate and aspartate (characterized) 33% 98% 129.4 toluene tolerance protein Ttg2A 43% 218.8
L-citrulline catabolism AO353_03040 lo ABC transporter for L-Arginine and L-Citrulline, ATPase component (characterized) 31% 99% 127.5 toluene tolerance protein Ttg2A 43% 218.8
D-maltose catabolism thuK lo ThuK aka RB0314 aka SMB20328, component of Trehalose/maltose/sucrose porter (trehalose inducible) (characterized) 34% 68% 126.7 toluene tolerance protein Ttg2A 43% 218.8
sucrose catabolism thuK lo ThuK aka RB0314 aka SMB20328, component of Trehalose/maltose/sucrose porter (trehalose inducible) (characterized) 34% 68% 126.7 toluene tolerance protein Ttg2A 43% 218.8
trehalose catabolism thuK lo ThuK aka RB0314 aka SMB20328, component of Trehalose/maltose/sucrose porter (trehalose inducible) (characterized) 34% 68% 126.7 toluene tolerance protein Ttg2A 43% 218.8
D-maltose catabolism aglK lo ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) 31% 66% 124.8 toluene tolerance protein Ttg2A 43% 218.8
sucrose catabolism aglK lo ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) 31% 66% 124.8 toluene tolerance protein Ttg2A 43% 218.8
trehalose catabolism aglK lo ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) 31% 66% 124.8 toluene tolerance protein Ttg2A 43% 218.8
lactose catabolism lacK lo ABC transporter for Lactose, ATPase component (characterized) 33% 65% 124 toluene tolerance protein Ttg2A 43% 218.8
L-histidine catabolism bgtA lo BgtA aka SLR1735, component of Arginine/lysine/histidine/glutamine porter (characterized) 32% 95% 122.5 toluene tolerance protein Ttg2A 43% 218.8
D-cellobiose catabolism TM0027 lo TM0027, component of β-glucoside porter (Conners et al., 2005). Binds cellobiose, laminaribiose (Nanavati et al. 2006). Regulated by cellobiose-responsive repressor BglR (characterized) 32% 85% 122.1 toluene tolerance protein Ttg2A 43% 218.8
L-tryptophan catabolism ecfA1 lo Energy-coupling factor transporter ATP-binding protein EcfA1; Short=ECF transporter A component EcfA; EC 7.-.-.- (characterized, see rationale) 34% 79% 120.9 toluene tolerance protein Ttg2A 43% 218.8
L-tryptophan catabolism ecfA2 lo Energy-coupling factor transporter ATP-binding protein EcfA2; Short=ECF transporter A component EcfA2; EC 7.-.-.- (characterized, see rationale) 32% 75% 115.9 toluene tolerance protein Ttg2A 43% 218.8
L-arabinose catabolism xylGsa lo Xylose/arabinose import ATP-binding protein XylG; EC 7.5.2.13 (characterized, see rationale) 30% 90% 111.7 toluene tolerance protein Ttg2A 43% 218.8

Sequence Analysis Tools

View WP_084276079.1 at NCBI

Find papers: PaperBLAST

Find functional residues: SitesBLAST

Search for conserved domains

Find the best match in UniProt

Compare to protein structures

Predict transmenbrane helices: Phobius

Predict protein localization: PSORTb

Find homologs in fast.genomics

Fitness BLAST: loading...

Sequence

MDEIIRIRGLKKSFGTKEVLKGVDLDIIKGKTTVILGLSGSGKSTIIKHIVRLLKPDSGE
VWVEGVDMARADEDEVYRMRKKIGYLFQSGALFDSMNVYENVAFPLHEHTNMSEEQIQKK
VRERLRTVGLNPDDVLELYPDELSGGMRKRVGLARSIVLDPGIILYDEPTSGLDPITSDL
ITRLIRNTQQELNVTSVLISHDIKESFKAGDYFAFLYDGKIIEYGDKEHFQNSTNPYVRQ
FLDGKAEGPIKIVR

This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory