Align Glucokinase; EC 2.7.1.2; Glucose kinase (uncharacterized)
to candidate WP_084457073.1 G494_RS0118450 hypothetical protein
Query= curated2:B2J224 (341 letters) >NCBI__GCF_000429965.1:WP_084457073.1 Length = 427 Score = 188 bits (478), Expect = 2e-52 Identities = 116/337 (34%), Positives = 180/337 (53%), Gaps = 19/337 (5%) Query: 2 TLLLAGDIGGTKTILQLVETSDSQGLHTIYQESYHSADFPDLVPIVQQFLIKANTPIPEK 61 +LLLA DIGGTKT L L + G + +++ + L ++ QFL P+ E+ Sbjct: 96 SLLLAADIGGTKTTLALYHRAQWPG-PPLAEQTMANHGTAGLEQLIAQFL----DPLAER 150 Query: 62 ---ACFAIAGPIVKNTAKLTNLAWFLDTERLQQELGIPHIYLINDFAAVGYGISGLQKQD 118 CF +AGP+ ++TNL+W + L+Q G ++L+ND A G S LQ + Sbjct: 151 PAYGCFGVAGPVRNQEVEMTNLSWRISAAALEQRFGFQQLHLLNDLMATAMGTSSLQADE 210 Query: 119 LHPLQVGKPQPETPIGIIGAGTGLGQGFLIKQGNNYQVFPSEGGHADFAPRNEIEFQLLK 178 L + G P + ++ GTGLG+ FL QG PSEGGHA FAPR + +LL Sbjct: 211 LVTINPGSPVAGGTVAVLAPGTGLGEAFL-TQGAQPTPHPSEGGHASFAPRTREQIELLC 269 Query: 179 YLLDKHDIQRISVERVVSGMGIVAIYQFLRDRKFAAESPDIAQIVRTWEQEAGQEEKSVD 238 ++L D +SVE+V SG G+ ++ FLR P +A+ + A +++ + Sbjct: 270 FMLQSRD--HVSVEQVCSGSGLPQLFAFLRTT--MGVPPALAEAL-----AASRDQTPLI 320 Query: 239 PGAAIGTAALEKRDRLSEQTLQLFIEAYGAEAGNLALKLLPYGGLYIAGGIAPKILPLIQ 298 +A+ +++ ++ +TL+LF EA NLALK L GGL++ GG+ P+ILP + Sbjct: 321 VASALKALQEGEQEHIAVRTLELFTAILADEAANLALKTLSLGGLFLGGGLPPRILPFFE 380 Query: 299 NSGFLLNFTQKGRMRPLLEEIPVYIILNPQVGLIGAA 335 + F+ F +G R L IP+ +ILNP+ + GAA Sbjct: 381 SCRFMSIFA-RGVYRDWLRTIPIQLILNPKTAIAGAA 416 Lambda K H 0.320 0.140 0.408 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 365 Number of extensions: 27 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 341 Length of database: 427 Length adjustment: 30 Effective length of query: 311 Effective length of database: 397 Effective search space: 123467 Effective search space used: 123467 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory