GapMind for catabolism of small carbon sources

 

Protein WP_084471964.1 in Haloglycomyces albus DSM 45210

Annotation: NCBI__GCF_000527155.1:WP_084471964.1

Length: 326 amino acids

Source: GCF_000527155.1 in NCBI

Candidate for 33 steps in catabolism of small carbon sources

Pathway Step Score Similar to Id. Cov. Bits Other hit Other id. Other bits
D-maltose catabolism aglG lo ABC transporter for D-Maltose and D-Trehalose, permease component 2 (characterized) 45% 69% 238.4 Membrane bound sugar transport protein, component of The glucosylglycerol uptake transporter (functions in osmoprotection and also transports sucrose and trehalose (Mikkat and Hagemann, 2000) (most similar to 3.A.1.1.8) 51% 280.0
sucrose catabolism aglG lo ABC transporter for D-Maltose and D-Trehalose, permease component 2 (characterized) 45% 69% 238.4 Membrane bound sugar transport protein, component of The glucosylglycerol uptake transporter (functions in osmoprotection and also transports sucrose and trehalose (Mikkat and Hagemann, 2000) (most similar to 3.A.1.1.8) 51% 280.0
trehalose catabolism aglG lo ABC transporter for D-Maltose and D-Trehalose, permease component 2 (characterized) 45% 69% 238.4 Membrane bound sugar transport protein, component of The glucosylglycerol uptake transporter (functions in osmoprotection and also transports sucrose and trehalose (Mikkat and Hagemann, 2000) (most similar to 3.A.1.1.8) 51% 280.0
D-cellobiose catabolism aglG' lo Inner membrane ABC transporter permease protein (characterized, see rationale) 42% 68% 220.3 Membrane bound sugar transport protein, component of The glucosylglycerol uptake transporter (functions in osmoprotection and also transports sucrose and trehalose (Mikkat and Hagemann, 2000) (most similar to 3.A.1.1.8) 51% 280.0
D-glucose catabolism aglG' lo Inner membrane ABC transporter permease protein (characterized, see rationale) 42% 68% 220.3 Membrane bound sugar transport protein, component of The glucosylglycerol uptake transporter (functions in osmoprotection and also transports sucrose and trehalose (Mikkat and Hagemann, 2000) (most similar to 3.A.1.1.8) 51% 280.0
lactose catabolism aglG' lo Inner membrane ABC transporter permease protein (characterized, see rationale) 42% 68% 220.3 Membrane bound sugar transport protein, component of The glucosylglycerol uptake transporter (functions in osmoprotection and also transports sucrose and trehalose (Mikkat and Hagemann, 2000) (most similar to 3.A.1.1.8) 51% 280.0
D-maltose catabolism aglG' lo Inner membrane ABC transporter permease protein (characterized, see rationale) 42% 68% 220.3 Membrane bound sugar transport protein, component of The glucosylglycerol uptake transporter (functions in osmoprotection and also transports sucrose and trehalose (Mikkat and Hagemann, 2000) (most similar to 3.A.1.1.8) 51% 280.0
sucrose catabolism aglG' lo Inner membrane ABC transporter permease protein (characterized, see rationale) 42% 68% 220.3 Membrane bound sugar transport protein, component of The glucosylglycerol uptake transporter (functions in osmoprotection and also transports sucrose and trehalose (Mikkat and Hagemann, 2000) (most similar to 3.A.1.1.8) 51% 280.0
trehalose catabolism aglG' lo Inner membrane ABC transporter permease protein (characterized, see rationale) 42% 68% 220.3 Membrane bound sugar transport protein, component of The glucosylglycerol uptake transporter (functions in osmoprotection and also transports sucrose and trehalose (Mikkat and Hagemann, 2000) (most similar to 3.A.1.1.8) 51% 280.0
D-cellobiose catabolism gtsC lo Sugar transport system permease protein aka TT_C0326, component of The glucose/mannose porter TTC0326-8 plus MalK1 (ABC protein, shared with 3.A.1.1.25) (characterized) 36% 90% 155.2 Membrane bound sugar transport protein, component of The glucosylglycerol uptake transporter (functions in osmoprotection and also transports sucrose and trehalose (Mikkat and Hagemann, 2000) (most similar to 3.A.1.1.8) 51% 280.0
D-glucose catabolism gtsC lo Sugar transport system permease protein aka TT_C0326, component of The glucose/mannose porter TTC0326-8 plus MalK1 (ABC protein, shared with 3.A.1.1.25) (characterized) 36% 90% 155.2 Membrane bound sugar transport protein, component of The glucosylglycerol uptake transporter (functions in osmoprotection and also transports sucrose and trehalose (Mikkat and Hagemann, 2000) (most similar to 3.A.1.1.8) 51% 280.0
lactose catabolism gtsC lo Sugar transport system permease protein aka TT_C0326, component of The glucose/mannose porter TTC0326-8 plus MalK1 (ABC protein, shared with 3.A.1.1.25) (characterized) 36% 90% 155.2 Membrane bound sugar transport protein, component of The glucosylglycerol uptake transporter (functions in osmoprotection and also transports sucrose and trehalose (Mikkat and Hagemann, 2000) (most similar to 3.A.1.1.8) 51% 280.0
D-maltose catabolism gtsC lo Sugar transport system permease protein aka TT_C0326, component of The glucose/mannose porter TTC0326-8 plus MalK1 (ABC protein, shared with 3.A.1.1.25) (characterized) 36% 90% 155.2 Membrane bound sugar transport protein, component of The glucosylglycerol uptake transporter (functions in osmoprotection and also transports sucrose and trehalose (Mikkat and Hagemann, 2000) (most similar to 3.A.1.1.8) 51% 280.0
D-mannose catabolism TT_C0326 lo Sugar transport system permease protein aka TT_C0326, component of The glucose/mannose porter TTC0326-8 plus MalK1 (ABC protein, shared with 3.A.1.1.25) (characterized) 36% 90% 155.2 Membrane bound sugar transport protein, component of The glucosylglycerol uptake transporter (functions in osmoprotection and also transports sucrose and trehalose (Mikkat and Hagemann, 2000) (most similar to 3.A.1.1.8) 51% 280.0
sucrose catabolism gtsC lo Sugar transport system permease protein aka TT_C0326, component of The glucose/mannose porter TTC0326-8 plus MalK1 (ABC protein, shared with 3.A.1.1.25) (characterized) 36% 90% 155.2 Membrane bound sugar transport protein, component of The glucosylglycerol uptake transporter (functions in osmoprotection and also transports sucrose and trehalose (Mikkat and Hagemann, 2000) (most similar to 3.A.1.1.8) 51% 280.0
trehalose catabolism gtsC lo Sugar transport system permease protein aka TT_C0326, component of The glucose/mannose porter TTC0326-8 plus MalK1 (ABC protein, shared with 3.A.1.1.25) (characterized) 36% 90% 155.2 Membrane bound sugar transport protein, component of The glucosylglycerol uptake transporter (functions in osmoprotection and also transports sucrose and trehalose (Mikkat and Hagemann, 2000) (most similar to 3.A.1.1.8) 51% 280.0
D-xylose catabolism gtsC lo ABC transporter for D-Glucose-6-Phosphate, permease component 1 (characterized) 32% 96% 145.2 Membrane bound sugar transport protein, component of The glucosylglycerol uptake transporter (functions in osmoprotection and also transports sucrose and trehalose (Mikkat and Hagemann, 2000) (most similar to 3.A.1.1.8) 51% 280.0
D-galactose catabolism PfGW456L13_1896 lo ABC transporter for D-Galactose and D-Glucose, permease component 2 (characterized) 32% 98% 142.1 Membrane bound sugar transport protein, component of The glucosylglycerol uptake transporter (functions in osmoprotection and also transports sucrose and trehalose (Mikkat and Hagemann, 2000) (most similar to 3.A.1.1.8) 51% 280.0
trehalose catabolism thuG lo ABC-type transporter, integral membrane subunit, component of Trehalose porter. Also binds sucrose (Boucher and Noll, 2011). Induced by glucose and trehalose. Directly regulated by trehalose-responsive regulator TreR (characterized) 30% 99% 134 Membrane bound sugar transport protein, component of The glucosylglycerol uptake transporter (functions in osmoprotection and also transports sucrose and trehalose (Mikkat and Hagemann, 2000) (most similar to 3.A.1.1.8) 51% 280.0
D-cellobiose catabolism glcU lo GlcU, component of Glucose, mannose, galactose porter (characterized) 31% 92% 131 Membrane bound sugar transport protein, component of The glucosylglycerol uptake transporter (functions in osmoprotection and also transports sucrose and trehalose (Mikkat and Hagemann, 2000) (most similar to 3.A.1.1.8) 51% 280.0
D-galactose catabolism glcU lo GlcU, component of Glucose, mannose, galactose porter (characterized) 31% 92% 131 Membrane bound sugar transport protein, component of The glucosylglycerol uptake transporter (functions in osmoprotection and also transports sucrose and trehalose (Mikkat and Hagemann, 2000) (most similar to 3.A.1.1.8) 51% 280.0
D-glucose catabolism glcU lo GlcU, component of Glucose, mannose, galactose porter (characterized) 31% 92% 131 Membrane bound sugar transport protein, component of The glucosylglycerol uptake transporter (functions in osmoprotection and also transports sucrose and trehalose (Mikkat and Hagemann, 2000) (most similar to 3.A.1.1.8) 51% 280.0
lactose catabolism glcU lo GlcU, component of Glucose, mannose, galactose porter (characterized) 31% 92% 131 Membrane bound sugar transport protein, component of The glucosylglycerol uptake transporter (functions in osmoprotection and also transports sucrose and trehalose (Mikkat and Hagemann, 2000) (most similar to 3.A.1.1.8) 51% 280.0
D-maltose catabolism glcU lo GlcU, component of Glucose, mannose, galactose porter (characterized) 31% 92% 131 Membrane bound sugar transport protein, component of The glucosylglycerol uptake transporter (functions in osmoprotection and also transports sucrose and trehalose (Mikkat and Hagemann, 2000) (most similar to 3.A.1.1.8) 51% 280.0
D-mannose catabolism glcU lo GlcU, component of Glucose, mannose, galactose porter (characterized) 31% 92% 131 Membrane bound sugar transport protein, component of The glucosylglycerol uptake transporter (functions in osmoprotection and also transports sucrose and trehalose (Mikkat and Hagemann, 2000) (most similar to 3.A.1.1.8) 51% 280.0
sucrose catabolism glcU lo GlcU, component of Glucose, mannose, galactose porter (characterized) 31% 92% 131 Membrane bound sugar transport protein, component of The glucosylglycerol uptake transporter (functions in osmoprotection and also transports sucrose and trehalose (Mikkat and Hagemann, 2000) (most similar to 3.A.1.1.8) 51% 280.0
trehalose catabolism glcU lo GlcU, component of Glucose, mannose, galactose porter (characterized) 31% 92% 131 Membrane bound sugar transport protein, component of The glucosylglycerol uptake transporter (functions in osmoprotection and also transports sucrose and trehalose (Mikkat and Hagemann, 2000) (most similar to 3.A.1.1.8) 51% 280.0
N-acetyl-D-glucosamine catabolism ngcG lo NgcG, component of N-Acetylglucosamine/N,N'-diacetyl chitobiose porter (NgcK (C) not identified) (characterized) 30% 92% 127.1 Membrane bound sugar transport protein, component of The glucosylglycerol uptake transporter (functions in osmoprotection and also transports sucrose and trehalose (Mikkat and Hagemann, 2000) (most similar to 3.A.1.1.8) 51% 280.0
D-glucosamine (chitosamine) catabolism ngcG lo NgcG, component of N-Acetylglucosamine/N,N'-diacetyl chitobiose porter (NgcK (C) not identified) (characterized) 30% 92% 127.1 Membrane bound sugar transport protein, component of The glucosylglycerol uptake transporter (functions in osmoprotection and also transports sucrose and trehalose (Mikkat and Hagemann, 2000) (most similar to 3.A.1.1.8) 51% 280.0
D-maltose catabolism thuG lo Trehalose/maltose transport system permease protein MalG (characterized) 30% 95% 126.3 Membrane bound sugar transport protein, component of The glucosylglycerol uptake transporter (functions in osmoprotection and also transports sucrose and trehalose (Mikkat and Hagemann, 2000) (most similar to 3.A.1.1.8) 51% 280.0
sucrose catabolism thuG lo ABC transporter for D-Trehalose, permease component 2 (characterized) 31% 95% 124.8 Membrane bound sugar transport protein, component of The glucosylglycerol uptake transporter (functions in osmoprotection and also transports sucrose and trehalose (Mikkat and Hagemann, 2000) (most similar to 3.A.1.1.8) 51% 280.0
D-maltose catabolism malG_Aa lo Binding-protein-dependent transport systems inner membrane component (characterized, see rationale) 31% 71% 106.7 Membrane bound sugar transport protein, component of The glucosylglycerol uptake transporter (functions in osmoprotection and also transports sucrose and trehalose (Mikkat and Hagemann, 2000) (most similar to 3.A.1.1.8) 51% 280.0
trehalose catabolism treU lo TreU, component of Trehalose porter (characterized) 30% 82% 82.4 Membrane bound sugar transport protein, component of The glucosylglycerol uptake transporter (functions in osmoprotection and also transports sucrose and trehalose (Mikkat and Hagemann, 2000) (most similar to 3.A.1.1.8) 51% 280.0

Sequence Analysis Tools

View WP_084471964.1 at NCBI

Find papers: PaperBLAST

Find functional residues: SitesBLAST

Search for conserved domains

Find the best match in UniProt

Compare to protein structures

Predict transmenbrane helices: Phobius

Predict protein localization: PSORTb

Find homologs in fast.genomics

Fitness BLAST: loading...

Sequence

MSQESTLTSDVGGSSDRRDDRRTESKPKRRSGMGWLSSRVGSAVAILIAVLWTLPTAGLF
INSLRSQDDIEDAGWWTTVRDPAFTVETYNYVLYSSGSGGGFANYFLNSLVIAVPSVLLP
IALGTMAAYALSWIRFRGRGIIFIGIFSLQIVPLQMSIVPLLSFFSDGLSLGGMTIVPPW
DLAGFERYIQIWIAHTVFGLPLAIFLLHNFIREIPADVVEAARMDGASHVQIFRSVVLPL
AAPAIASISIFQFLWVWNDYLVGLVFGGGPMTNPLTVQLANMAGTYGDNWTRLPAAAFVS
IIVPLMVFLVLQRYFVRGLLAGSVKG

This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory