Align UDP-glucose 4-epimerase; Galactowaldenase; UDP-galactose 4-epimerase; EC 5.1.3.2 (characterized)
to candidate WP_084511392.1 G491_RS29845 UDP-N-acetylglucosamine 4,6-dehydratase (inverting)
Query= SwissProt::Q9ZDJ5 (341 letters) >NCBI__GCF_000429905.1:WP_084511392.1 Length = 418 Score = 221 bits (562), Expect = 3e-62 Identities = 127/286 (44%), Positives = 180/286 (62%), Gaps = 16/286 (5%) Query: 4 DKTLMITGGTGSFGN----AVLSRFLKSNIINDIKEIRIFSRDEKKQEDMRIALNNSKLK 59 ++ +++TGGTGSFG ++L+R+ + + IR++SRDE KQ +MR KL+ Sbjct: 85 NQCILVTGGTGSFGKHFCRSILARY-------NPRVIRVYSRDELKQHEMRREFGEEKLR 137 Query: 60 FYIGDVRNYQSIDDAMHGVDYVFHAAALKQVPTCEFYPMEAINTNVLGAENVLSAAINNK 119 ++IGDVR+ + + AM GVD V HAAALKQVP CE+ P+EA+ TN++GA+N++ AAI+ Sbjct: 138 YFIGDVRDKERMRRAMEGVDIVVHAAALKQVPACEYNPLEAVKTNIIGAQNIIDAAIDAG 197 Query: 120 VTKVIVLSTDKAVYPINAMGLSKALMEKLAIAKARMRSPGETILCVTRYGNVMASRGSVI 179 V KV+ LSTDKAV P+N G +K EK+ I T RYGNV+ SRGSVI Sbjct: 198 VKKVMALSTDKAVNPVNLYGATKLCAEKIFIQGNSYTGERGTCFSCVRYGNVIGSRGSVI 257 Query: 180 PLFIHQIKQGKELTITEPSMTRFLMSLVDSVDLVLYAFEHGRQGDIFVQKSPASTIEVLA 239 PLF+ Q K GK +T+T+ MTRF ++L +V+LV+ H + G+IFV P+ + LA Sbjct: 258 PLFLEQAKTGK-VTVTDSRMTRFWITLDRAVELVVNGLTHMQGGEIFVPIIPSMKVMDLA 316 Query: 240 KALQEIFGSKNAIRFIGTRHGEKHYESLVSSEDMAKADDLGGYYRI 285 KA+ G K + FIG R GEK +ES+++ ED G Y I Sbjct: 317 KAVAP--GCK--VDFIGIRPGEKLHESMITEEDGRNTIAYKGMYVI 358 Lambda K H 0.319 0.135 0.373 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 347 Number of extensions: 19 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 341 Length of database: 418 Length adjustment: 30 Effective length of query: 311 Effective length of database: 388 Effective search space: 120668 Effective search space used: 120668 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory