Align enoyl-CoA hydratase (EC 4.2.1.17) (characterized)
to candidate WP_084517118.1 H567_RS0110060 enoyl-CoA hydratase/isomerase family protein
Query= BRENDA::P76082 (255 letters) >NCBI__GCF_000422285.1:WP_084517118.1 Length = 294 Score = 179 bits (453), Expect = 8e-50 Identities = 103/257 (40%), Positives = 145/257 (56%), Gaps = 4/257 (1%) Query: 2 SELIVSRQQRVLLLTLNRPAARNALNNALLMQLVNELEAAATDTSISVCVITGNA-RFFA 60 +E+++ + Q + +TLNRP+ N+ N L L L A T SV VITG + F+ Sbjct: 37 AEILLGKDQGIWTITLNRPSYMNSFNKTALQSLAEYLRLAKESTDCSVVVITGQGPKAFS 96 Query: 61 AGADLNEMAE---KDLAATLNDTRPQLWARLQAFNKPLIAAVNGYALGAGCELALLCDVV 117 +GAD++ E K L + ++A L KP IAA+NG A G ELAL C Sbjct: 97 SGADVHTFLEEKKKALGIDWSKLGQNVFAMLDEIGKPSIAAINGIAFGGAFELALACTFR 156 Query: 118 VAGENARFGLPEITLGIMPGAGGTQRLIRSVGKSLASKMVLSGESITAQQAQQAGLVSDV 177 +A E ARF PEI LG +PG GGTQR R +G ++A +++L+G I A +A G+VS V Sbjct: 157 IASEEARFSFPEINLGFIPGWGGTQRATRLLGPAVALELILTGSVIDASRALALGIVSQV 216 Query: 178 FPSDLTLEYALQLASKMARHSPLALQAAKQALRQSQEVALQAGLAQERQLFTLLAATEDR 237 P D +E A +LA KM PLA++ A +A+ +V+L+ GL E L + +ED Sbjct: 217 VPGDRLMETARELALKMVGKPPLAIRFALEAVHAGLDVSLKEGLKLEGGLAAMAVLSEDA 276 Query: 238 HEGISAFLQKRTPDFKG 254 EGI AF +KR P F+G Sbjct: 277 QEGIKAFFEKRKPVFRG 293 Lambda K H 0.318 0.130 0.356 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 127 Number of extensions: 4 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 294 Length adjustment: 25 Effective length of query: 230 Effective length of database: 269 Effective search space: 61870 Effective search space used: 61870 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory