Align ABC transporter ATP-binding protein (characterized, see rationale)
to candidate WP_084545016.1 H566_RS24645 branched-chain amino acid ABC transporter permease
Query= uniprot:A0A165KER0 (358 letters) >NCBI__GCF_000482785.1:WP_084545016.1 Length = 366 Score = 127 bits (320), Expect = 4e-34 Identities = 99/338 (29%), Positives = 166/338 (49%), Gaps = 39/338 (11%) Query: 12 AVALLVLPLILQSFGNAWVRIADLALLYVLLA-LGLNIVVGYAGLLDLGYVAFYAVGAYL 70 AVA LV+P + + W L L + LA LGLN++ GY G L +G AF AVGA+ Sbjct: 35 AVAWLVVPAVADDY---WFSAVLLPFLVLALAGLGLNLLTGYTGQLSVGSAAFMAVGAFA 91 Query: 71 FALMASPHLADNFAAFAAMFPNGLHTSLWIVIPVAALLAAFFGAMLGAPTLKLRGDYLAI 130 NF+ P L + + +AA FG ++G P+L+++G YL + Sbjct: 92 ---------TYNFSLRLPGLP------LLASLALGGGVAALFGVLVGLPSLRIKGFYLIV 136 Query: 131 VTLGFGEIIR-IFLNNLDHPVNLTNGPKGLGQIDSVKVFGLDLGKRLEVFGFDINSVTLY 189 TL ++ +F+ G + G+ +L V G D+++ Sbjct: 137 STLAAQFFVQWVFVK--------------FGWFSNYSSSGVITAPKLAVAGIDLSAPAGR 182 Query: 190 YYLFLVLVVVSVIICYRLQDSRIGRAWMAIREDEIAAKAMGINTRNMKLLAFGMGASFGG 249 Y L L +V V ++ L S GR WMA+R+ + AA ++GI KLLAF + + + G Sbjct: 183 YLLTLGVVCVLTLLARNLVRSTTGRHWMAVRDMDTAAASLGIPILRTKLLAFAVSSFYLG 242 Query: 250 VSGAMFG-AFQGFVSPESFSLMESVMIVAMVVLGGIGHIPGVILGAVLLSALPEVLRYVA 308 V+GA++ A+ G V + F+L S ++ +V++GG+G + G GA + P L + + Sbjct: 243 VAGALWAFAYLGTVEADGFNLNRSFQVLFIVIIGGLGSLAGSFWGAAFIVLFPIGLSHAS 302 Query: 309 GPLQA--MTDGRLDSAILRQLLIALAMIIIMLLRPRGL 344 L A + G+L++ ++++ L +I ++ P GL Sbjct: 303 DALFAGSIDPGQLEN--FQRIVFGLLIIGFLVREPDGL 338 Lambda K H 0.328 0.144 0.430 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 313 Number of extensions: 20 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 358 Length of database: 366 Length adjustment: 29 Effective length of query: 329 Effective length of database: 337 Effective search space: 110873 Effective search space used: 110873 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory