Align Hydroxymethylglutaryl-CoA lyase YngG; HL; HMG-CoA lyase; 3-hydroxy-3-methylglutarate-CoA lyase; EC 4.1.3.4 (characterized)
to candidate WP_084545021.1 H566_RS0111785 hydroxymethylglutaryl-CoA lyase
Query= SwissProt::O34873 (299 letters) >NCBI__GCF_000482785.1:WP_084545021.1 Length = 349 Score = 241 bits (615), Expect = 2e-68 Identities = 129/288 (44%), Positives = 178/288 (61%), Gaps = 1/288 (0%) Query: 5 KKVTIKEVGPRDGLQNEPVWIATEDKITWINQLSRTGLSYIEITSFVHPKWIPALRDAID 64 +++ + EVGPRDG Q EPV++ T DKI I+ LS G + IE T+FV PK +PAL DA + Sbjct: 37 RRLWLNEVGPRDGFQVEPVFVPTADKIALIDALSALGFAKIEATAFVSPKAVPALADAAE 96 Query: 65 VAKGIDREKGVTYAALVPNQRGLENALEGGINEACVFMSASETHNRKNINKSTSESLHIL 124 V +GI R GV YAALVPN RG E A+ G +E + MSASETHN N+ + +S Sbjct: 97 VMRGIRRAPGVVYAALVPNARGAEAAIAAGADELNLVMSASETHNLANLRMTREQSFAQF 156 Query: 125 KQVNNDAQKANLTTRAYLSTVFGCPYEKDVPIEQVIRLSEALF-EFGISELSLGDTIGAA 183 V A+ A LS FGCP E +V +V+ E E G++ ++L DT G A Sbjct: 157 GAVVALARAAGRAVNVSLSCSFGCPMEGEVAAAEVLGWVERFTGELGVTRVALCDTTGMA 216 Query: 184 NPAQVETVLEALLARFPANQIALHFHDTRGTALANMVTALQMGITVFDGSAGGLGGCPYA 243 P QVE ++ A+L R+P ++ LHFHDTRG LAN++ A G T FD + GGLGGCPYA Sbjct: 217 FPPQVEALVGAVLTRWPGLELTLHFHDTRGLGLANLLAAAGAGATRFDMALGGLGGCPYA 276 Query: 244 PGSSGNAATEDIVYMLEQMDIKTNVKLEKLLSAAKWIEEKMGKPLPSR 291 PG++GN +ED+V+ L M T + LE L++A++ + +G+ P + Sbjct: 277 PGATGNVCSEDVVHALALMGYDTGIDLEGLIAASRRLPALIGRETPGQ 324 Lambda K H 0.315 0.132 0.381 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 253 Number of extensions: 12 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 299 Length of database: 349 Length adjustment: 28 Effective length of query: 271 Effective length of database: 321 Effective search space: 86991 Effective search space used: 86991 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory