Align 2-deoxy-D-ribonate 3-dehydrogenase (characterized)
to candidate WP_084545086.1 H566_RS0112475 NAD(P)-dependent oxidoreductase
Query= reanno::BFirm:BPHYT_RS04775 (263 letters) >NCBI__GCF_000482785.1:WP_084545086.1 Length = 291 Score = 125 bits (314), Expect = 1e-33 Identities = 83/251 (33%), Positives = 123/251 (49%), Gaps = 14/251 (5%) Query: 12 GLRVLISGAAAGIGAAIAQAFLDVGANVYICDVDPAAIDRARTAHPQLHAGV----ADVS 67 G L++GAA G+G AIAQA D GA V + D+D A A A + A AD+ Sbjct: 43 GRVALVTGAARGLGHAIAQALADHGARVVLADIDAAGASAAADALAERGARAVSLAADLG 102 Query: 68 DCAQVDRIIDDARSKLGGLDLLINNAGIAGPTGAVEDLDPAEWERTIGTNLNSQFYFLRK 127 D V R+ A + G +D L+ NAGI GP G + A+W R + NL Sbjct: 103 DRTSVARLAAQATAAFGRIDTLVCNAGIEGPVGPLGAATEADWRRVMDVNLGGALALCSA 162 Query: 128 AVPLLKETSANPGIIAMASVAGRLGYAFRTPYAASKWAIVGMVKSLAIELGPNNVRVNAI 187 +P + E + ++ M+S+AG G YA SK + + ++LA+E GP+ VRVNA+ Sbjct: 163 VIPPMAE-RGDGSVVLMSSIAGLRGNRAIGLYALSKAGLAQLARNLAVEWGPSGVRVNAV 221 Query: 188 LPGVVEGERMDRVISARAESLGIGFDQMKGEYLQKISLRRMVTVHDVAAMALFLASPAGQ 247 PG+V +++ +A L LRR+ H++A + + LAS AG Sbjct: 222 SPGLVRTPLAAGLLADQA---------FMARRLAATPLRRVGEPHEIAGVVVMLASRAGG 272 Query: 248 NISGQAISVDG 258 + G + VDG Sbjct: 273 FMHGHNLVVDG 283 Lambda K H 0.320 0.136 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 202 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 263 Length of database: 291 Length adjustment: 25 Effective length of query: 238 Effective length of database: 266 Effective search space: 63308 Effective search space used: 63308 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory