Align glucokinase (EC 2.7.1.1; EC 2.7.1.2; EC 2.7.1.8) (characterized)
to candidate WP_084545272.1 H566_RS26265 glucokinase
Query= ecocyc::GLUCOKIN-MONOMER (321 letters) >NCBI__GCF_000482785.1:WP_084545272.1 Length = 680 Score = 228 bits (580), Expect = 4e-64 Identities = 131/343 (38%), Positives = 182/343 (53%), Gaps = 36/343 (10%) Query: 6 LVGDVGGTNARLALCDIASGEISQAKTYSGLDYPSLEAVIRVYLEEHKV-EVKDGCIAIA 64 L+ D+G TNAR AL G + + D+PS+ +R YL + +AIA Sbjct: 43 LLADIGATNARFAL-QWPGGGVESVAVLACDDHPSIVEAMRAYLAMQTAPRPRHAAVAIA 101 Query: 65 CPITGDWVAMTNHTWAFSIAEMKKNLGFSHLEIINDFTAVSMAIPMLKKEHLIQFGGAEP 124 PI GD+V MTN W FSI E ++ L + L ++NDFTA++MA+P+L + + Q GG P Sbjct: 102 NPIDGDFVKMTNRDWHFSIEETRRALDLATLLVVNDFTALAMALPLLGPDDVRQIGGGAP 161 Query: 125 VEGKPIAVYGAGTGLGVAHLVHVDKRWVSLPGEGGHVDFAPNSEEEAIILEILRAEIGHV 184 E I + G GTGLGV+ L+ D RW++L EGGHV F+P E +L+ E+ HV Sbjct: 162 RENSVIGLIGPGTGLGVSGLIPADDRWITLGSEGGHVSFSPMDAREIALLQFAWGELDHV 221 Query: 185 SAERVLSGPGLVNLYRAIVKADNRLPENLKPKDITERALA--------------DSCTD- 229 S ER++SGPG+ RA+ + L+ +I ERA+A + +D Sbjct: 222 SYERLVSGPGMELTLRALAEQAGVEAPALRAPEIVERAMAAADAARLASAGNSGAAASDT 281 Query: 230 -------------------CRRALSLFCVIMGRFGGNLALNLGTFGGVFIAGGIVPRFLE 270 C + FC ++G ++A+ LG GG++I GG+VPR E Sbjct: 282 ALASGSTPGSPAVDPADALCLDTVECFCRMLGTVASDVAVTLGAVGGIYIGGGVVPRLGE 341 Query: 271 FFKASGFRAAFEDKGRFKEYVHDIPVYLIVHDNPGLLGSGAHL 313 F SGFRA FE KGRF+ Y+ DIP YLI NP LG GA L Sbjct: 342 LFDRSGFRARFEHKGRFEGYLRDIPTYLITAPNPAFLGVGAIL 384 Lambda K H 0.322 0.141 0.426 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 584 Number of extensions: 27 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 321 Length of database: 680 Length adjustment: 33 Effective length of query: 288 Effective length of database: 647 Effective search space: 186336 Effective search space used: 186336 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory