Align NatA aka BRAF aka SLR0467, component of Leucine/proline/alanine/serine/glycine (and possibly histidine) porter, NatABCDE (characterized)
to candidate WP_084572795.1 DL86_RS07995 LPS export ABC transporter ATP-binding protein
Query= TCDB::Q55164 (267 letters) >NCBI__GCF_000746085.1:WP_084572795.1 Length = 294 Score = 144 bits (363), Expect = 2e-39 Identities = 86/255 (33%), Positives = 137/255 (53%), Gaps = 17/255 (6%) Query: 14 PESS--LLLAQGLSKSFGGLRAVDHADIVVKEGSITGLIGPNGAGKTTLFNLLSNFIRPD 71 P+S+ +L + L K++ R V+ +VV+ G GL+GPNGAGKTTLF +++ +RPD Sbjct: 51 PQSAEGILAVRHLRKAYKARRVVEDVSMVVRRGEAVGLLGPNGAGKTTLFYMITGLVRPD 110 Query: 72 QGEVLFNGDSIGQLAPHQIALRGSVRTFQVAKVLSRLTVLENMLLADQHQTGEKFLPRLI 131 G + +G + +L ++ A G Q A + L+V +N+ Sbjct: 111 DGAIELDGHDVTRLPMYRRARLGIGYLPQEASIFRGLSVEDNIRAV-------------- 156 Query: 132 NFRRVQKEERANREKAMAMLESVGLGAKAQDYAGALSGGQRKLLEMARALMSNPKLILLD 191 Q ++R ++ A+LE + A + A ALSGG+R+ E+ARAL S P +LLD Sbjct: 157 -LEITQPDKRKRGDELEALLEEFAITALRKSPAVALSGGERRRCEIARALASRPSFMLLD 215 Query: 192 EPAAGVNPTLIGQICEHIVNWNRQGITFLVIEHNMDVIMTLCHHVWVLAEGRNLADGTPE 251 EP AG++P IG I + + R+GI L+ +HN+ + L +++ GR L +G+P Sbjct: 216 EPFAGIDPISIGDIQLLVQHLKRRGIGVLITDHNVRETLHLIDRAYIIHGGRVLTEGSPA 275 Query: 252 QIQSDPRVLEAYLGD 266 I +DP V YLG+ Sbjct: 276 DIVADPDVRRFYLGE 290 Lambda K H 0.319 0.136 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 184 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 267 Length of database: 294 Length adjustment: 26 Effective length of query: 241 Effective length of database: 268 Effective search space: 64588 Effective search space used: 64588 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory