GapMind for catabolism of small carbon sources

 

Protein WP_084705084.1 in Beijerinckia mobilis UQM 1969

Annotation: NCBI__GCF_000745425.1:WP_084705084.1

Length: 403 amino acids

Source: GCF_000745425.1 in NCBI

Candidate for 34 steps in catabolism of small carbon sources

Pathway Step Score Similar to Id. Cov. Bits Other hit Other id. Other bits
L-asparagine catabolism aapQ hi AapQ, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 47% 95% 327.8 ABC transporter for D-Alanine, permease component 2 47% 313.2
L-aspartate catabolism aapQ hi AapQ, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 47% 95% 327.8 ABC transporter for D-Alanine, permease component 2 47% 313.2
L-glutamate catabolism aapQ hi AapQ, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 47% 95% 327.8 ABC transporter for D-Alanine, permease component 2 47% 313.2
L-histidine catabolism aapQ hi AapQ, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 47% 95% 327.8 ABC transporter for D-Alanine, permease component 2 47% 313.2
L-leucine catabolism aapQ hi AapQ, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 47% 95% 327.8 ABC transporter for D-Alanine, permease component 2 47% 313.2
L-proline catabolism aapQ hi AapQ, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 47% 95% 327.8 ABC transporter for D-Alanine, permease component 2 47% 313.2
D-alanine catabolism Pf6N2E2_5403 med ABC transporter for D-Alanine, permease component 2 (characterized) 47% 99% 313.2 AapQ, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) 47% 327.8
L-asparagine catabolism bgtB' med ABC-type permease for basic amino acids and glutamine (characterized, see rationale) 43% 98% 247.3 AapQ, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) 47% 327.8
L-aspartate catabolism bgtB' med ABC-type permease for basic amino acids and glutamine (characterized, see rationale) 43% 98% 247.3 AapQ, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) 47% 327.8
L-asparagine catabolism bztB lo glutamate/glutamine/aspartate/asparagine transport system permease protein BztB (characterized) 40% 96% 260 AapQ, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) 47% 327.8
L-aspartate catabolism bztB lo glutamate/glutamine/aspartate/asparagine transport system permease protein BztB (characterized) 40% 96% 260 AapQ, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) 47% 327.8
L-glutamate catabolism bztB lo glutamate/glutamine/aspartate/asparagine transport system permease protein BztB (characterized) 40% 96% 260 AapQ, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) 47% 327.8
L-asparagine catabolism natG lo NatG, component of Acidic and neutral amino acid uptake transporter NatFGH/BgtA. BgtA is shared with BgtAB (characterized) 54% 58% 172.9 AapQ, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) 47% 327.8
L-aspartate catabolism natG lo NatG, component of Acidic and neutral amino acid uptake transporter NatFGH/BgtA. BgtA is shared with BgtAB (characterized) 54% 58% 172.9 AapQ, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) 47% 327.8
L-asparagine catabolism aatM lo Glutamate/aspartate import permease protein GltK (characterized) 36% 67% 90.5 AapQ, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) 47% 327.8
L-aspartate catabolism aatM lo Glutamate/aspartate import permease protein GltK (characterized) 36% 67% 90.5 AapQ, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) 47% 327.8
L-glutamate catabolism gltK lo Glutamate/aspartate import permease protein GltK (characterized) 36% 67% 90.5 AapQ, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) 47% 327.8
L-glutamate catabolism gluC lo GluC aka CGL1952, component of Glutamate porter (characterized) 38% 64% 88.6 AapQ, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) 47% 327.8
L-histidine catabolism Ac3H11_2554 lo ABC transporter for L-Histidine, permease component 1 (characterized) 34% 58% 88.2 AapQ, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) 47% 327.8
L-asparagine catabolism aatQ lo Glutamate/aspartate import permease protein GltJ (characterized) 38% 52% 87.8 AapQ, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) 47% 327.8
L-aspartate catabolism aatQ lo Glutamate/aspartate import permease protein GltJ (characterized) 38% 52% 87.8 AapQ, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) 47% 327.8
L-glutamate catabolism gltJ lo Glutamate/aspartate import permease protein GltJ (characterized) 38% 52% 87.8 AapQ, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) 47% 327.8
L-asparagine catabolism aapM lo AapM, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 31% 50% 82.8 AapQ, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) 47% 327.8
L-aspartate catabolism aapM lo AapM, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 31% 50% 82.8 AapQ, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) 47% 327.8
L-glutamate catabolism aapM lo AapM, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 31% 50% 82.8 AapQ, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) 47% 327.8
L-histidine catabolism aapM lo AapM, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 31% 50% 82.8 AapQ, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) 47% 327.8
L-leucine catabolism aapM lo AapM, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 31% 50% 82.8 AapQ, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) 47% 327.8
L-proline catabolism aapM lo AapM, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 31% 50% 82.8 AapQ, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) 47% 327.8
L-asparagine catabolism peb1D lo Amino acid ABC transporter, permease protein PEB1 (characterized, see rationale) 38% 56% 79.7 AapQ, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) 47% 327.8
L-aspartate catabolism peb1D lo Amino acid ABC transporter, permease protein PEB1 (characterized, see rationale) 38% 56% 79.7 AapQ, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) 47% 327.8
L-lysine catabolism hisQ lo Amino acid ABC transporter, membrane protein (characterized, see rationale) 30% 92% 77 AapQ, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) 47% 327.8
D-glucosamine (chitosamine) catabolism AO353_21720 lo ABC transporter for D-glucosamine, permease component 2 (characterized) 30% 62% 72.4 AapQ, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) 47% 327.8
L-histidine catabolism BPHYT_RS24010 lo Polar amino acid ABC transporter, inner membrane subunit (characterized, see rationale) 30% 64% 68.9 AapQ, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) 47% 327.8
L-histidine catabolism BPHYT_RS24005 lo Polar amino acid ABC transporter, inner membrane subunit; Flags: Precursor (characterized, see rationale) 32% 57% 63.5 AapQ, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) 47% 327.8

Sequence Analysis Tools

View WP_084705084.1 at NCBI

Find papers: PaperBLAST

Find functional residues: SitesBLAST

Search for conserved domains

Find the best match in UniProt

Compare to protein structures

Predict transmenbrane helices: Phobius

Predict protein localization: PSORTb

Find homologs in fast.genomics

Fitness BLAST: loading...

Sequence

MIGFQPFSLKRSITKILAGKGLAGEVLARWYNPAWRNTAVQVLFVLVLAAILAILGWNLR
ANMLARNIPTDFSFWNDTAGFDINQTPIAYSPLSTYGRAFFVGLLNTLIVAAIALVLTTI
IGVIVGIGRLAENRLVSLLAATYVEVLRNIPLLLQLLFWYNAILKPLPGPRQSLIMPLGA
VLNNRGLFLPRPSFEAGAAGVAGALAIGLALAYLVWHFSILKPGWPRNLLILLLAVGPAI
GFSLHMPPLALDFPILKGFNYAGGFRVSPEFVALLLGLSLYTAAFIAEIVRAGINSVPRG
QSEAAASLGLPPGLTMRLIILPQALRVVIPPLTSQYLNLVKNSSLAVFIGYPDLVQVFTG
TVLNQTGAAVQVILITMAVYLGLSLMISFAMNHLNRRMAFVER

This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory