Align acetolactate synthase (subunit 1/2) (EC 2.2.1.6) (characterized)
to candidate WP_085120738.1 B9O00_RS01970 acetolactate synthase small subunit
Query= BRENDA::P00894 (163 letters) >NCBI__GCF_900177295.1:WP_085120738.1 Length = 182 Score = 128 bits (322), Expect = 4e-35 Identities = 74/161 (45%), Positives = 107/161 (66%), Gaps = 3/161 (1%) Query: 2 RRILSVLLENESGALSRVIGLFSQRGYNIESLTVAPTD-DPTLSRMTIQTVGDEKVLEQI 60 +R ++VL++NE G L+RVIGLFS RGYNIESLTV+ D + LSR+T+ T G ++LEQI Sbjct: 21 KRTIAVLVDNEPGVLARVIGLFSGRGYNIESLTVSEVDQENRLSRITVVTSGTPQILEQI 80 Query: 61 EKQLHKLVDVLRVSELGQ-GAHVEREIMLVKIQASGYGRDEVKRNTEIFRGQIIDVTPSL 119 + QL +LV V RV +L G VERE+ LVK+ +G R E R +IF+ +++D Sbjct: 81 KAQLDRLVPVHRVRDLTMAGGFVERELALVKVAGTGEKRVEALRIADIFKAEVVDAGLDY 140 Query: 120 YTVQLAGTSGKLDAFLASIRDVAKIVEVARSGVVGLSRGDK 160 + Q+ S K+D F+ +R + +VE+AR+GVV + RG K Sbjct: 141 FVFQIQHRSDKVDRFIELMRPLG-LVELARTGVVAILRGAK 180 Lambda K H 0.318 0.136 0.360 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 96 Number of extensions: 5 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 163 Length of database: 182 Length adjustment: 18 Effective length of query: 145 Effective length of database: 164 Effective search space: 23780 Effective search space used: 23780 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 44 (21.6 bits)
Align candidate WP_085120738.1 B9O00_RS01970 (acetolactate synthase small subunit)
to HMM TIGR00119 (ilvN: acetolactate synthase, small subunit (EC 2.2.1.6))
../bin/blast/fastacmd -i /tmp/list.21690.in -d ../tmp/orgsDef_201/orgs.faa -p T > /tmp/gapView.21690.genome.faa failed: Inappropriate ioctl for device at ../lib/pbutils.pm line 379.
For help, please send mail to the webmaster (help@microbesonline.org), giving this error message and the time and date of the error.