Align L-glutamate gamma-semialdehyde dehydrogenase (EC 1.2.1.88) (characterized)
to candidate WP_085770042.1 B1812_RS01610 aldehyde dehydrogenase family protein
Query= BRENDA::Q65NN2 (516 letters) >NCBI__GCF_002117405.1:WP_085770042.1 Length = 474 Score = 218 bits (556), Expect = 3e-61 Identities = 147/462 (31%), Positives = 232/462 (50%), Gaps = 22/462 (4%) Query: 56 INPANKEEVVGTVSKATQDHAEKAIQAAAKAFETWRYTDPEERAAVLFRAVAKVRRKKHE 115 INPA E V G ++ + ++A+ AA +AF+++ T ER +L R V ++ ++ + Sbjct: 25 INPAT-EAVCGHIALGSATDVDRAVAAAGEAFKSFSRTSRRERLELLQRIVVELEKRHED 83 Query: 116 FSALLVKEAGKP-WNEADADTAEAIDFMEYYARQMIELAKGKPVNSREGERNQYVYTPTG 174 + + +E G P W A A+A +++ IE+ K R G V P G Sbjct: 84 MARAITEEMGAPVWL---AQRAQARMGAAHFSTA-IEVLKRYEFEERRGA-TIIVKEPIG 138 Query: 175 VTVVIPPWNFLFAIMAGTTVAPIVTGNTVVLKPASAAPVIAAKFVEVLEESGLPKGVVNF 234 V I PWN+ MA + TG +VLKP+ AP E LE +G P GV N Sbjct: 139 VCGFITPWNWPLNQMACKIAPALATGCAMVLKPSEIAPFSGIVLAEALEAAGTPPGVFNL 198 Query: 235 VPGSGAEVGDYLVDHPKTSIITFTGSREVGTRIFERAAKVQPGQTHLKQVIAEMGGKDTV 294 V G G VG + HP S+++FTGS G + + AA +K++ E+GGK Sbjct: 199 VNGDGPTVGAAISSHPGVSMVSFTGSTRAGVEVAKNAAPT------VKRICQELGGKSPN 252 Query: 295 VVDEDCDIELAAQSIFTSAFGFAGQKCSAGSRAVVHEKVYDEVLKRVIEITESKKVGEPD 354 ++ ED D++ A + + +GQ C+A +R + K +EV+ E+ VG+P Sbjct: 253 ILLEDADMKAAVTAGVNAVMLNSGQSCNAPTRMLAPRKRMEEVIGFARSAAEATTVGDP- 311 Query: 355 SADVYMGPVIDQASFNKIMDYIEIGKEEG-RLVSGGKGDD---SKGYFIEPTIFADLDPK 410 + + MGPV+ +A +NK+ I+ G EEG LV+GG G KGY+++PT+FA++ Sbjct: 312 NGNAQMGPVVSEAQWNKVQGLIQKGLEEGASLVAGGLGKPEGLEKGYYVKPTVFANVTND 371 Query: 411 ARLMQEEIFGPVVAFSKVSSFDEALEVANNTEYGLTGAVITKNRDHINRAKQEFHVGNLY 470 + +EEIFGPV++ +A+E+AN+TEYGL+ V + + G + Sbjct: 372 MTIAREEIFGPVLSILAYDRVADAIEIANDTEYGLSAYVSGADPARLMETASRLRAGQVQ 431 Query: 471 FNRNCTGAIVGYHPFGGFKMSGTDSKAGGPDYLALHMQAKTI 512 N + PFGG+KMSG + + G A ++ K I Sbjct: 432 LNSAPMDLMA---PFGGYKMSG-NGREWGDHAFAEFLETKAI 469 Lambda K H 0.315 0.133 0.382 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 586 Number of extensions: 32 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 516 Length of database: 474 Length adjustment: 34 Effective length of query: 482 Effective length of database: 440 Effective search space: 212080 Effective search space used: 212080 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory