Align Phosphomannomutase/phosphoglucomutase; PMM / PGM; EC 5.4.2.2; EC 5.4.2.8 (uncharacterized)
to candidate WP_085770160.1 B1812_RS02305 phosphomannomutase/phosphoglucomutase
Query= curated2:Q88C93 (463 letters) >NCBI__GCF_002117405.1:WP_085770160.1 Length = 499 Score = 251 bits (642), Expect = 3e-71 Identities = 167/471 (35%), Positives = 249/471 (52%), Gaps = 30/471 (6%) Query: 14 FRAYDIRGVVGKTLHAETAYWIGRAIGAQSLAQGEP-QVSVGRDGRLSGPMLVEQLIKGL 72 FR YD R + K L+ +G +G G P +++ G D R + L+ GL Sbjct: 27 FREYDARWLFEKELNLMGVQALGLGLGTLLHEMGAPLELATGHDYRSYSASIKLALVTGL 86 Query: 73 VDAGCNVSDVGLVPTPALYYAANVLAGKSGVMLTGSHNPSDYNGFKIVIAGDTLANEQIQ 132 + AG V D+GL +P Y+A L + M+T SHN + + G K+ Sbjct: 87 MAAGVKVQDIGLALSPMAYFAQFELDCAAVAMVTASHNDNGWTGVKMGAQRPVTFGP--- 143 Query: 133 ALLTRLKTNDLT-----LAQGRVEKVEIL-DRYFKQIVGDVKLAKKLKVVVDCGNGAAGV 186 +TRLK L+ + G VE RY + +VKL +KLKVV CGNG AG Sbjct: 144 VEMTRLKEIVLSGKYREASGGSYHYVENFGQRYLDDLAKNVKLTRKLKVVAACGNGTAGA 203 Query: 187 VAPQLIEALGCEVIPLFCEVDGNFPNHHPDPGKPENLEDLIAKVKETGADIGLAFDGDGD 246 APQL+ +GCEV+PL E+D FP ++P+P L + KV+E+GAD+GL FDGDGD Sbjct: 204 FAPQLLGRVGCEVVPLDVELDYTFPRYNPNPEDMHMLHAMADKVRESGADVGLGFDGDGD 263 Query: 247 RVGVVTNTGSIVYPDRLLMLFAQDVLSRNPGAEIIFDVKCTRRLT--PLIEQHGGRALMW 304 R GVV N G ++ D++ ++ A+D+ +P A + DVK T P + G + W Sbjct: 264 RCGVVDNKGEEIFADKIGVMLARDLSRVHPDARFVVDVKSTGLFATDPELIGRGVKTDYW 323 Query: 305 KTGHSLIKKKMKQTGSLLAGEMSGHIFI-KERWYGFDDGIYSAARLLEILSKT-EQSAEN 362 KTGHS IK+++ + G+L E SGH F K G+DDG+ +A +LE+L + +S + Sbjct: 324 KTGHSYIKRRVNELGALAGFEKSGHFFFNKPIGRGYDDGLLTALHVLEMLDRNPTKSMSD 383 Query: 363 LFAAFPNDISTPEINIDVTDEGKFSIIDALQRDADWGEA-----------NLTTIDGVRV 411 L+AA P +P + DE K++++D + +A +L T++GVRV Sbjct: 384 LYAALPKTWGSPTMAPHCADEIKYTVVDRVTERFKKMQADGVSFLGGPIRDLVTVNGVRV 443 Query: 412 DYANG-WGLVRASNTTPVLVLRFEADSDAELQRIKDVFRT--QLLRVEPEL 459 +G WGLVRAS+ P LV+ E S A R++++F ++LR PE+ Sbjct: 444 TVGDGTWGLVRASSNKPELVVVVE--SPASEARMREMFHAVDKVLRENPEV 492 Lambda K H 0.319 0.138 0.406 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 580 Number of extensions: 36 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 463 Length of database: 499 Length adjustment: 34 Effective length of query: 429 Effective length of database: 465 Effective search space: 199485 Effective search space used: 199485 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory